CAZyme Information: MGYG000004314_00848

Basic Information

• Species: Varibaculum timonense
• Lineage: Bacteria; Actinobacteriota; Actinomycetia; Actinomycetales; Actinomycetaceae; Varibaculum; Varibaculum timonense
• CAZyme ID: MGYG000004314_00848
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
601	MGYG000004314_6|CGC1	70463.97	4.9284

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004314	2027678	MAG	Israel	Asia

• Gene Location: Start: 54842; End: 56647 Strand: +

Full Sequence      

MNYLRNEYPRPQFERENWINLNGVWNFCFDDEDKGLQQRWYLSNQPFDRKINVPFVYESE
LSGINCQDRHDIIWYKREFELPELSPQENLILHFGAVDYQAKVFLNGQLVKEHTGGETPF
SVNITPFLKEETSQSLCLRVYDPLENQEIPRGKQFWESCSKGIWYTRSSGIWQTVWMEVV
EHQHIESLGMKPDVDKGSVELSIGLKNQNKNNWIDLRIYYRDLLVTETRTRCIENRLKIT
VDIVQSDIFKTGFHGPEEYIWSPEYPNLFSVELTLIDSDSQRERDFIKSYFGMRKIHSEN
GIIYLNNKPYYQKLILDQGYWPKSLLTAPSDADYRQDITLAKQMGFNGCRKHQKLEDPRF
LYWADKLGYLVWEECSSTPLFTTQSQIAILDSWKETYLRDRNHPCIVAWVPLNESWGVPN
IHADESQQHWAQSLYHFLHSLDNTRLVSSNDGWDQTITDICAIHNYRFGRSVVDSEFTDF
RENLESKETLVSQLISGRPVYANGFDYKGEPILITECGGIGFATDQASDWSYLNVSSDSD
FLSAYRRLISALYSSKDVQGFCYTQLTDVEQEVNGLLTYDRKPKFDLEKLREINANNKLY
S

Enzyme Prediction     

EC	3.2.1.23

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	12	596	2e-100	0.6183510638297872

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	4.57e-37	8	414	3	417	beta-D-glucuronidase; Provisional
COG3250	LacZ	7.29e-36	11	447	6	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.33e-23	13	460	33	485	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	1.06e-18	21	177	4	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
PRK09525	lacZ	1.46e-15	20	460	54	499	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADI66561.1	0.0	1	601	1	601
QQU07937.1	0.0	1	601	1	601
QQT13622.1	0.0	1	601	1	601
AUJ86695.1	7.18e-238	5	594	3	588
ATF71437.1	4.11e-237	5	594	3	588

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.52e-83	7	595	28	580	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
4JHZ_A	2.90e-27	21	584	17	580	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12],4JHZ_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 2-[4-(1,3-benzodioxol-5-ylmethyl)piperazin-1-yl]-N-[(1S,2S,5S)-2,5-dimethoxycyclohexyl]acetamide [Escherichia coli K-12]
3LPF_A	2.93e-27	21	584	17	580	Structureof E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPF_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 1-((6,7-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(3-methoxyphenyl)thiourea [Escherichia coli K-12],3LPG_A Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],3LPG_B Structure of E. coli beta-Glucuronidase bound with a novel, potent inhibitor 3-(2-fluorophenyl)-1-(2-hydroxyethyl)-1-((6-methyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)urea [Escherichia coli K-12],5CZK_A Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12],5CZK_B Structure of E. coli beta-glucuronidase bound with a novel, potent inhibitor 1-((6,8-dimethyl-2-oxo-1,2-dihydroquinolin-3-yl)methyl)-1-(2-hydroxyethyl)-3-(4-hydroxyphenyl)thiourea [Escherichia coli K-12]
6LEM_B	3.84e-27	21	584	13	576	ChainB, Beta-D-glucuronidase [Escherichia coli]
6LEJ_B	3.88e-27	21	584	15	578	ChainB, Beta-D-glucuronidase [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P05804	2.12e-26	21	584	15	578	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
P77989	7.49e-25	20	415	18	389	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	1.49e-24	8	474	43	479	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
Q6LL68	9.21e-15	4	474	64	507	Beta-galactosidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=lacZ PE=3 SV=1
O52847	3.68e-14	11	447	83	504	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004314_00848.