CAZyme Information: MGYG000004303_01315

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; RUG13868
• CAZyme ID: MGYG000004303_01315
• CAZy Family: CBM50
• CAZyme Description: Peptidoglycan endopeptidase LytF

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
277	MGYG000004303_22|CGC1	30504.34	4.6406

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004303	1641642	MAG	Israel	Asia

• Gene Location: Start: 6821; End: 7654 Strand: +

Full Sequence      

MNTYTVLRGDTLYGIAKKFNTSVQSIKELNNLTSDNISVGQRLIVKNDGDSTPNECIVYT
VKKGDNLYSIARKYGTSVDDIKRYNGLTSNLLDVGDRLVIPCEDSGSEYKPLENNYISYT
VKKGDSLYSIAKKFDTTVDKIMDDNDLSSDDLDIGMILVIDDKSGTSSVKECFGSGDVPD
TVGGVEYVVARGDNLYSIAKRFDVSVESIKKENNLTSDNLQIGDVLIIPTSSIKTYKVQK
GESLYSIAKKFNVTVDYLKDKNNLTGNLISVGQELII

Enzyme Prediction     

No EC number prediction in MGYG000004303_01315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM50	59	101	8.8e-17	0.975

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	3.96e-34	3	277	332	591	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	1.69e-23	3	98	345	444	membrane-bound lytic murein transglycosylase D; Provisional
PRK06347	PRK06347	5.16e-19	114	275	328	521	1,4-beta-N-acetylmuramoylhydrolase.
PRK10783	mltD	9.50e-19	30	142	320	428	membrane-bound lytic murein transglycosylase D; Provisional
PRK10783	mltD	7.14e-16	163	275	312	444	membrane-bound lytic murein transglycosylase D; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACL69398.1	4.67e-46	4	229	147	358
UAC47898.1	2.94e-45	3	237	186	420
QOY35011.1	2.12e-41	3	231	101	311
AXY24739.1	4.15e-39	3	228	665	883
API89943.1	2.14e-38	3	228	780	1017

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B8V_A	1.59e-12	48	229	35	217	ChainA, Extracellular Protein 6 [Fulvia fulva],4B9H_A Chain A, Extracellular Protein 6 [Fulvia fulva]
4UZ2_A	1.35e-08	59	104	5	50	Crystalstructure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ2_D Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4UZ3_A Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_B Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8],4UZ3_C Crystal structure of the N-terminal LysM domains from the putative NlpC/P60 D,L endopeptidase from T. thermophilus bound to N-acetyl-chitohexaose [Thermus thermophilus HB8]
4XCM_A	1.20e-07	59	104	5	50	Crystalstructure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8],4XCM_B Crystal structure of the putative NlpC/P60 D,L endopeptidase from T. thermophilus [Thermus thermophilus HB8]
2MKX_A	8.02e-07	59	100	7	48	Solutionstructure of LysM the peptidoglycan binding domain of autolysin AtlA from Enterococcus faecalis [Enterococcus faecalis V583]
1E0G_A	4.25e-06	55	100	1	45	LYSMDomain from E.coli MLTD [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31852	1.91e-27	3	232	28	272	D-gamma-glutamyl-meso-diaminopimelic acid endopeptidase CwlS OS=Bacillus subtilis (strain 168) OX=224308 GN=cwlS PE=1 SV=1
O07532	1.90e-26	2	228	92	350	Peptidoglycan endopeptidase LytF OS=Bacillus subtilis (strain 168) OX=224308 GN=lytF PE=1 SV=2
P37710	7.67e-23	4	228	363	608	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P54421	1.10e-22	6	168	30	200	Probable peptidoglycan endopeptidase LytE OS=Bacillus subtilis (strain 168) OX=224308 GN=lytE PE=1 SV=1
Q49UX4	9.62e-22	3	196	28	223	N-acetylmuramoyl-L-alanine amidase sle1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229 / NCIMB 8711 / NCTC 7292 / S-41) OX=342451 GN=sle1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004303_01315.