CAZyme Information: MGYG000004299_00440

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-1193
• CAZyme ID: MGYG000004299_00440
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
355	MGYG000004299_4|CGC1	42458.69	6.4937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004299	1113187	MAG	Israel	Asia

• Gene Location: Start: 20282; End: 21349 Strand: -

Full Sequence      

MKVCVYAICKNEEKFIERWYQSIKDADYICVLDTGSCDNSVSLLKKLGVNVKEEIINPFR
FDVARNKALSMVPDDIDICISLDLDEVIKPNWKEELNRIYKPEINRVRYLYNWSLDEFDK
PIVSFYCDKIHSRNNYKWINPVHEILKYEKDNEVYVNSNIVINHYPDSSKSRGSYLGLLE
LSVKENPENDRNMHYLGREYMFYKRWNDAIDTLIKHLHLKSATWKDERCASMRFIARCYK
NLNRYDEAYMWCDKAIKQTPNLRDPYMEKAVIADDLKDYDVVIDCCLNALKIKEKNLYYI
NEYFNNEVFIYDLLSLAYYYTGNYKQSLKYVDLAIKEDPKNERLLKNKILIEDKI

Enzyme Prediction     

No EC number prediction in MGYG000004299_00440.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd02511	Beta4Glucosyltransferase	1.38e-15	2	166	1	165	UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide. UDP-glucose: lipooligosaccharide (LOS) beta-1-4-glucosyltransferase catalyzes the addition of the first residue, glucose, of the lacto-N-neotetrase structure to HepI of the LOS inner core. LOS is the major constituent of the outer leaflet of the outer membrane of gram-positive bacteria. It consists of a short oligosaccharide chain of variable composition (alpha chain) attached to a branched inner core which is lined in turn to lipid A. Beta 1,4 glucosyltransferase is required to attach the alpha chain to the inner core.
sd00006	TPR	1.13e-08	235	336	7	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
sd00006	TPR	4.36e-07	193	291	4	97	Tetratricopeptide repeat. The Tetratricopeptide repeat (TPR) typically contains 34 amino acids and is found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans. It is present in a variety of proteins including those involved in chaperone, cell-cycle, transcription, and protein transport complexes. The number of TPR motifs varies among proteins. Those containing 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accommodate an alpha-helix of a target protein. It has been proposed that TPR proteins preferentially interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes.
pfam00535	Glycos_transf_2	8.18e-07	4	143	1	150	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam14853	Fis1_TPR_C	2.91e-05	313	355	6	48	Fis1 C-terminal tetratricopeptide repeat. The mitochondrial fission protein Fis1 consists of two tetratricopeptide repeats. This domain is the C-terminal tetratricopeptide repeat

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AQS58818.1	2.25e-118	1	354	4	359
AQS58819.1	9.71e-118	1	355	4	360
QOX65321.1	1.07e-113	2	355	5	360
QPJ85366.1	4.47e-113	2	355	5	360
ACV63878.1	3.50e-112	1	353	4	357

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004299_00440.