CAZyme Information: MGYG000004298_00269

Basic Information

• Lineage: Bacteria; Proteobacteria; Alphaproteobacteria; RF32; CAG-977; UBA11549
• CAZyme ID: MGYG000004298_00269
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
271	MGYG000004298_3|CGC1	31616.33	8.6902

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004298	2105780	MAG	Israel	Asia

• Gene Location: Start: 74742; End: 75557 Strand: -

Full Sequence      

MIPKKIHYCWFGPAPKGEVETKCIESWKKFLPDYEIREWNDADLEKFDNRYLKQAVSAKK
WAFVSDYVRLYALLAEGGVYFDTDEEIRKPLDDFMNFDFFIGSQKCGSCRSISPALIGTL
PGHRIVRDLIAEYDNIDFIKPDGSFNLTTNPMYFAKVFKEKYGIEDVFVTKDRVKIMENA
YIYPYTYFCTDNAEAYGVHHYTGSWKPDWNVREKLSIPLGKGKRLILRKYKKNREGGKMP
FNDNEKVLCSLKTSKRSKLFLLLQNNGENAC

Enzyme Prediction     

No EC number prediction in MGYG000004298_00269.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	20	96	3.4e-20	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.43e-13	1	94	81	177	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	3.69e-13	17	93	1	85	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	5.88e-06	1	133	45	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	0.001	31	93	145	212	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AJA44712.1	3.84e-73	2	264	4	264
QIM65043.1	4.29e-70	2	264	4	265
QXF34380.1	2.09e-69	1	264	1	261
VEJ13839.1	6.91e-69	2	264	4	263
QUC06113.1	5.95e-67	2	262	3	261

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004298_00269.