CAZyme Information: MGYG000004294_00278

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004294_00278
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
265	MGYG000004294_2|CGC2	30225.3	5.6274

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004294	2151848	MAG	Israel	Asia

• Gene Location: Start: 126833; End: 127630 Strand: -

Full Sequence      

MSSEMKIPKTIHYIWFGGKPLPPMAERCINSWKEHCPDYEIVRWDEDSFDSGGNRYFEEA
LAAKKWAFASDYARLKVLVEHGGIYMDTDVEVLRPLDRFLEEDAFSGFETPSRISTGLMA
CRRSFPLFERLLQDYEGRAFALSDGSYDETTNVVAITNACLELGLELNGGKQTVEGFTLY
PKDFFSPKDHKTRQVHLTENAYVIHHFDGSWLPDETVAYKQAKERLIAAHPKMPYSITSG
LALLGLCIEAGSMKPYKVWTENRGR

Enzyme Prediction     

No EC number prediction in MGYG000004294_00278.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	26	102	5.2e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	2.06e-23	2	136	77	215	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	8.71e-18	27	105	6	92	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam05704	Caps_synth	4.07e-10	2	135	41	191	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.
pfam12919	TcdA_TcdB	3.55e-06	9	49	1	41	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.002	45	123	147	221	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST53065.1	6.94e-89	7	263	2	258
QUT95860.1	9.83e-89	7	263	2	258
BBK91625.1	9.59e-86	7	227	2	222
QJE27088.1	1.54e-83	7	214	2	209
QYR65866.1	8.69e-74	7	226	2	221

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004294_00278.