CAZyme Information: MGYG000004290_02637

Basic Information

• Species: Alistipes sp900549305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900549305
• CAZyme ID: MGYG000004290_02637
• CAZy Family: CE9
• CAZyme Description: N-acetylglucosamine-6-phosphate deacetylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416		44086.48	5.7789

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004290	3325933	MAG	China	Asia

• Gene Location: Start: 57; End: 1307 Strand: -

Full Sequence      

MKTLLSIFGLLACCLPAAAEAPHRVKIVNAAVVMPSRVVENATILIEDGRIAAVGVDLRD
AFEGAEVIDAAGRYAAPGFIDVHCHGGGGHDFSDGTVEAMLGAAEMHAQHGTTLIYPTTA
SCSNATLFSLFDTYRKAAKRNTRGAAFGGIHIEGGYLSMEMKGGQDPRYIKNPTPEDYNA
ILAKGGDLIARWTFAPELPGSAALIGELSRRGIQMSMGHTSALYDEAVDAYDAGVNSITH
FYSMCSGVTRRNALRYAGVIEAGYLLDGIYVETIGDGIHLPEPLLRLIWKVKGPDRIVGI
TDAMRGAGMPDGPTILGSLDDGMAAIIEDGVAKLPDRSSFAGSVCTTDRVVRNYVTKAGA
SLPEAVQVMTLSPARLMHIDDRKGSIAPGKDADIVLFDEGIDISLTMIGGKVVYRK

Enzyme Prediction     

No EC number prediction in MGYG000004290_02637.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE9	28	410	1.4e-107	0.9946380697050938

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00854	NagA	9.15e-133	26	410	1	374	N-acetylglucosamine-6-phosphate deacetylase, NagA, catalyzes the hydrolysis of the N-acetyl group of N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to glucosamine 6-phosphate and acetate. This is the first committed step in the biosynthetic pathway to amino-sugar-nucleotides, which is needed for cell wall peptidoglycan and teichoic acid biosynthesis. Deacetylation of N-acetylglucosamine is also important in lipopolysaccharide synthesis and cell wall recycling.
COG1820	NagA	5.74e-110	27	415	4	380	N-acetylglucosamine-6-phosphate deacetylase [Carbohydrate transport and metabolism].
TIGR00221	nagA	5.59e-78	22	411	2	380	N-acetylglucosamine-6-phosphate deacetylase. [Central intermediary metabolism, Amino sugars]
PRK11170	nagA	5.48e-51	38	413	15	379	N-acetylglucosamine-6-phosphate deacetylase; Provisional
cd01297	D-aminoacylase	1.32e-23	42	415	20	404	D-aminoacylases (N-acyl-D-Amino acid amidohydrolases) catalyze the hydrolysis of N-acyl-D-amino acids to produce the corresponding D-amino acids, which are used as intermediates in the synthesis of pesticides, bioactive peptides, and antibiotics.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64809.1	4.27e-154	24	416	3	393
QRX64347.1	2.64e-150	23	416	3	396
SCD19170.1	8.67e-149	23	416	3	396
AYQ35214.1	5.93e-148	24	416	2	391
AEI48316.1	2.40e-147	24	416	2	391

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FV3_A	1.48e-45	77	411	66	390	Crystalstructure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_B Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_C Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155],6FV3_D Crystal structure of N-acetyl-D-glucosamine-6-phosphate deacetylase from Mycobacterium smegmatis. [Mycolicibacterium smegmatis MC2 155]
1O12_A	1.67e-45	77	416	55	375	Crystalstructure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution [Thermotoga maritima],1O12_B Crystal structure of N-acetylglucosamine-6-phosphate deacetylase (TM0814) from Thermotoga maritima at 2.5 A resolution [Thermotoga maritima]
6FV4_A	2.11e-44	77	411	66	390	Thestructure of N-acetyl-D-glucosamine-6-phosphate deacetylase D267A mutant from Mycobacterium smegmatis in complex with N-acetyl-D-glucosamine-6-phosphate [Mycolicibacterium smegmatis MC2 155],6FV4_B The structure of N-acetyl-D-glucosamine-6-phosphate deacetylase D267A mutant from Mycobacterium smegmatis in complex with N-acetyl-D-glucosamine-6-phosphate [Mycolicibacterium smegmatis MC2 155]
2VHL_A	1.42e-42	31	414	11	388	TheThree-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis],2VHL_B The Three-dimensional structure of the N-Acetylglucosamine-6- phosphate deacetylase from Bacillus subtilis [Bacillus subtilis]
7NUT_A	1.32e-38	69	415	57	403	ChainA, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUT_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_A Chain A, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens],7NUU_B Chain B, N-acetylglucosamine-6-phosphate deacetylase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q84F86	5.59e-47	29	412	10	381	N-acetylglucosamine-6-phosphate deacetylase OS=Lysinibacillus sphaericus OX=1421 GN=nagA PE=2 SV=1
Q6P0U0	6.47e-43	68	416	56	404	N-acetylglucosamine-6-phosphate deacetylase OS=Danio rerio OX=7955 GN=amdhd2 PE=2 SV=1
O34450	7.76e-42	31	414	11	388	N-acetylglucosamine-6-phosphate deacetylase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagA PE=1 SV=1
Q8XAC3	1.01e-41	46	411	24	373	N-acetylgalactosamine-6-phosphate deacetylase OS=Escherichia coli O157:H7 OX=83334 GN=agaA PE=1 SV=2
P44537	5.83e-40	45	411	22	377	N-acetylglucosamine-6-phosphate deacetylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=nagA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000590	0.710811	0.287708	0.000340	0.000285	0.000241

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004290_02637.