CAZyme Information: MGYG000004290_00537

Basic Information

• Species: Alistipes sp900549305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900549305
• CAZyme ID: MGYG000004290_00537
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
620	MGYG000004290_17|CGC1	68678.34	6.1374

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004290	3325933	MAG	China	Asia

• Gene Location: Start: 18476; End: 20338 Strand: +

Full Sequence      

MKKTIIIITLLLTQAASAASHGGKITGVRLGGYIGSRIDECIAGRVMTQDLDEILRPYAH
KTETSLWQSEFWGKWMLGACDSYRYNGDKALLSKIEYAVNELLKTQSPDGYIGNYAPEAR
LAQWDVWGQKYTLLGLQAYYGISHDKRVLDAARRVADYLLSLVGPDGADIATLGNYRGLA
AGSILEPMVFLYNNTGDVRYLDFAEWIVSRWETPAGPQLVSKALAGIPVAERFLPVPDAM
HWTDNGHKAYEMMSCYIGLLELYKVTGNPSYLKAVEMAAGKIIEQEITIAGSASSTECFW
HGAQRQTTPAYLSNETCVTYTWMELCDRLYRITGSPVYVDQVEKSMYNALQAALKRGGKN
IASYVPLEGFRRIGERQCGLNFNCCEANGPRGFALIPALALTTEANTVYVNLYNPMSGTV
VTSAADRITLDVATDYPATGSIAVEIGTKKPVAFALALRIPLWSRNNRVSVNGEAITDAI
LPGSYCKIERLWKPGDKVTLELELEGRLIFLNESQAILRGPVVFARDSRFNDGFVDETVA
IEHDAGNRVVMSPIGADKPEFAWLAFRVNALTSIYSGDKQSFRPIAVCDFGSAGNTWDES
TRYKVWLPRTIETADRHTWW

Enzyme Prediction     

No EC number prediction in MGYG000004290_00537.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	68	525	3.4e-56	0.8886679920477137

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	1.11e-67	73	525	61	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	5.98e-52	24	539	13	514	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	0.003	83	288	559	748	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	3.53e-181	8	611	8	610
QOY86860.1	1.31e-42	74	560	97	578
QWG10444.1	3.10e-37	59	524	89	576
AZQ63834.1	4.18e-37	59	524	89	576
BBD44699.1	7.21e-37	86	607	8	514

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.66e-29	78	531	78	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
5MQO_A	4.21e-24	68	528	90	610	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	2.50e-21	92	524	98	559	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	1.70e-19	92	524	98	559	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999130	0.000160	0.000156	0.000153	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004290_00537.