CAZyme Information: MGYG000004290_00025

Basic Information

• Species: Alistipes sp900549305
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp900549305
• CAZyme ID: MGYG000004290_00025
• CAZy Family: GH97
• CAZyme Description: Retaining alpha-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
668	MGYG000004290_1|CGC1	74489.34	5.1638

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004290	3325933	MAG	China	Asia

• Gene Location: Start: 32063; End: 34069 Strand: +

Full Sequence      

MKKIVVIALFTLLAGVAAAREKSYTVSSPDGTIGITLSLGERFAYEVHVDGRPVVAPTPI
AMTLDDGSVWGGPAQPSRIRKGTADTSFATPFYIKERVADRYNWLRADFRQGFALEFRAY
DDGVAYRFVSMTDKPLVIASEEAGARFPGDWTCWVPYVRDCDGAEIVPFGSQFKTSFENL
YTVARLSELDPARLAFLPLVVAADNGVKLCFTEADLQAYPGMYFNYPGQGASLRGVFAPY
PKRTHDGGHDNLQNVVDEYADFIAKAAPRASFPWRTVLIAREDRQLLDNDMVMRLAEPSR
LEDVSWIRPGLAAWEWWNDWGLYGVGFEAGVNTPTYKHYIDFAARNGVEYLVMDDGWSKD
KTDLMSGGSDRLDLEEVLRYAKQKGVGIILWAGYRAFDRDMEAVCRHYSALGVKGFKVDF
MDRDDQQIAEFLYRGAATAAKYGLLLDYHGIYKPAGLQRTYPNVVNFEGVHGLEQMKWSD
ESVDQVTYDVTMPFIRMTAGPVDYTQGAMLNAAKGHFFPRRSEPMSQGTRCRQLAEYIVF
HAPLSMLCDSPSNYDREPECTAFICGVPTVWDRTVALDGRLGEYAAVARCKGDVWYVGGL
TGHEGRTVTVDLGFLGEGNFTTELFCDGVNAAKYGHDYQRVIRALGSDRTLEITMAPAGG
FALRITRE

Enzyme Prediction     

EC	3.2.1.22

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH97	16	665	8.9e-187	0.9873217115689382

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10566	Glyco_hydro_97	2.33e-120	303	568	1	278	Glycoside hydrolase 97. This domain is the catalytic region of the bacterial glycosyl-hydrolase family 97. This central part of the GH97 family protein sequences represents a typical and complete (beta/alpha)8-barrel or catalytic TIM-barrel type domain. The N- and C-terminal parts of the sequences, mainly consisting of beta-strands, form two additional non-catalytic domains. In all known glycosidases with the (beta-alpha)8-barrel fold, the amino acid residues at the active site are located on the C-termini of the beta-strands.
pfam14508	GH97_N	7.49e-65	28	298	1	235	Glycosyl-hydrolase 97 N-terminal. This N-terminal domain of glycosyl-hydrolase-97 contributes part of the active site pocket. It is also important for contact with the catalytic and C-terminal domains of the whole.
pfam14509	GH97_C	8.53e-36	571	666	1	97	Glycosyl-hydrolase 97 C-terminal, oligomerization. Glycosyl-hydrolase-97 is made up of three tightly linked and highly conserved globular domains. The C-terminal domain is found to be necessary for oligomerization of the whole molecule in order to create the active-site pocket and the Ca++-binding site.
cd14791	GH36	4.61e-05	317	391	6	84	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL15907.1	0.0	1	668	1	669
BBL03717.1	0.0	12	668	1	658
BBL06723.1	9.25e-273	19	667	20	665
AFL78004.1	4.16e-272	1	667	1	667
BBK85735.1	4.86e-265	21	668	20	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3A24_A	2.29e-256	28	665	6	640	Crystalstructure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron],3A24_B Crystal structure of BT1871 retaining glycosidase [Bacteroides thetaiotaomicron]
5E1Q_A	4.32e-255	28	665	20	654	Mutant(D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482],5E1Q_B Mutant (D415G) GH97 alpha-galactosidase in complex with Gal-Lac [Bacteroides thetaiotaomicron VPI-5482]
5HQC_A	1.83e-60	25	664	2	657	AGlycoside Hydrolase Family 97 enzyme R171K variant from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQ4_A	2.52e-60	25	664	2	657	AGlycoside Hydrolase Family 97 enzyme from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8],5HQA_A A Glycoside Hydrolase Family 97 enzyme in complex with Acarbose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]
5HQB_A	6.60e-60	25	664	2	657	AGlycoside Hydrolase Family 97 enzyme (E480Q) in complex with Panose from Pseudoalteromonas sp. strain K8 [Pseudoalteromonas sp. K8]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A6L0	8.56e-259	1	665	1	661	Retaining alpha-galactosidase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_1871 PE=1 SV=1
D7CFN7	9.69e-58	6	662	17	617	Probable retaining alpha-galactosidase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=SBI_01652 PE=3 SV=1
G8JZS4	7.38e-48	2	665	4	723	Glucan 1,4-alpha-glucosidase SusB OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000329	0.998907	0.000263	0.000174	0.000170	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004290_00025.