CAZyme Information: MGYG000004287_01891

Basic Information

• Species: Limosilactobacillus caviae
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Lactobacillaceae; Limosilactobacillus; Limosilactobacillus caviae
• CAZyme ID: MGYG000004287_01891
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000004287_12|CGC1	39039.93	10.0576

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004287	2159846	MAG	China	Asia

• Gene Location: Start: 37443; End: 38480 Strand: -

Full Sequence      

MIKFVASHLSGNGGTETVLVPVLNHFAKSNSVELVIFGAPNNDYWLSKLNSNIKVRIINY
SGKFSKLLSFTQEAFSIKKNDLLISLSPSFIKLSSLLRKAKLSNFKIISWIHFSLVDQDL
FNPHDITYADYHLAISNKIKKQLVSLGVAEKNIAVIYNPIKQERIWHSQQHDGVNIAYIG
RISFKGQKNLKELFDGLKNSSNTNLFIVGNGSKEEIAKCKNYIAQNQITSKVTWAGWQKD
PWRYLEDKNIDGVILTSKFEGLPMVFLESISRGIPVISSRFDGYDDVVKNGVNGFSYQSG
NIDGLTKAIIKIKDIKDKKEIQGSINEFYNDNYFAKLNNIIKKIY

Enzyme Prediction     

No EC number prediction in MGYG000004287_01891.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	173	317	1.2e-23	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09922	PRK09922	7.24e-101	2	344	3	356	lipopolysaccharide 1,6-galactosyltransferase.
cd03811	GT4_GT28_WabH-like	2.65e-52	2	305	2	318	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03820	GT4_AmsD-like	1.53e-32	1	308	1	315	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
COG0438	RfaB	2.82e-24	1	308	3	335	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.09e-21	176	308	5	137	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP37101.1	8.18e-97	2	337	5	339
SFV41421.1	1.06e-95	2	341	3	343
ADJ79524.1	2.56e-95	2	344	5	347
ABE00328.1	2.56e-95	2	344	5	347
QXL49267.1	5.14e-95	2	344	5	347

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5N7Z_A	5.03e-56	2	341	3	353	glycosyltransferasein LPS biosynthesis [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],6Y6G_A Chain A, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5N80_A	5.16e-56	2	341	4	354	glycosyltransferaseLPS biosynthesis in complex with UDP [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
6Y6I_A	5.29e-56	2	341	5	355	ChainA, Lipopolysaccharide 1,6-galactosyltransferase [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5D00_A	1.47e-06	126	312	144	337	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]
2JJM_A	2.02e-06	126	319	154	352	CrystalStructure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_B Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_C Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_D Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_E Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_F Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_G Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_H Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_I Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_J Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_K Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames],2JJM_L Crystal Structure of a family GT4 glycosyltransferase from Bacillus anthracis ORF BA1558. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q06994	2.75e-55	2	341	3	353	Lipopolysaccharide 1,6-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaB PE=1 SV=2
P27127	2.31e-53	2	341	3	351	Lipopolysaccharide 1,6-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaB PE=3 SV=2
Q58469	3.35e-11	1	333	6	374	Uncharacterized glycosyltransferase MJ1069 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1069 PE=3 SV=1
Q9R9N1	2.24e-08	172	312	167	301	Lipopolysaccharide core biosynthesis glycosyltransferase LpsE OS=Rhizobium meliloti (strain 1021) OX=266834 GN=lpsE PE=3 SV=1
Q58577	4.22e-07	121	336	131	331	Uncharacterized glycosyltransferase MJ1178 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1178 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999822	0.000210	0.000003	0.000001	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004287_01891.