CAZyme Information: MGYG000004281_02028

Basic Information

• Species: Parabacteroides sp900552465
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides; Parabacteroides sp900552465
• CAZyme ID: MGYG000004281_02028
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
789	MGYG000004281_23|CGC1	91149.15	7.3921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004281	4813571	MAG	China	Asia

• Gene Location: Start: 43345; End: 45714 Strand: +

Full Sequence      

MRKILFPILALMFFVSSAKTQTRDWNAPPYAEDYAFITNDGAWCWFSDPRAIYVDNKMFG
GFVDKEGSIWAFSYDPETQLRQQYKLSDRFNYDDHANPSVMELPDKRLVIYFSAHGGTVN
SPIYYAVSKNPADISSWENLQSIDPKMPGSLGVCYTNAAMLSEEANRTYLFFRGRNFKPT
CIYSDDLKTWSDPVSIVVNDSLYGESGRPYMKVTTNHKNKIFFAFTDAHPRDRATNSIYF
MMYKDGKLCKADGSVISEKLGPVMPSQTDKVYDATKTFDKAWIWDVAFDKNENPVLVYAR
FSHACSIHSYWYAKWDGGKWVNIKITDAAQCFMRNDYNNKNYLETEENYSGGVYLDHENP
SVVYTSRPINNVFEIEKWTLTGGENVWKSEAVTKDSERDNIRPFVVRNHSGNQPDVLWVY
NYKYPGFRSYESAIRVNQKAKGFDSGFNKEAIKVVATAVADWQLRDYETAPFNSSVARGW
RNGVLYNGMFDWAVLSDNDKYFKYLENVFDKESWQVGNRMYNADDICVAQAYLDMYSRYK
KEYMLIPTLARGEWVVNHQPEGNIDITKGHSDRWWWCDALYMAPAVYSRLYTITGNKSFM
KFADKELKATYDHLYDKKEKLFYRDAKYFVKREANGEKIFWGRGNGWVMGGLAELLKTLP
ENDKMFRPFYVKLFKEMSTRVAELQCEDGFWRASLLDPVTYSDPEISSTGLFVYALAYGI
NQGYISKEKYLPVVIKGWKALVASVDTEGKVGWVQPVGQAPKRIEKRMTQVYGTGGFLMA
ACEVYRLVE

Enzyme Prediction     

No EC number prediction in MGYG000004281_02028.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	477	786	3.1e-85	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.04e-86	455	787	1	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	8.15e-52	450	787	6	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
pfam15892	BNR_4	1.09e-27	61	326	5	272	BNR repeat-containing family member. BNR_4 is a family which carries the unique sequence motif SxDxGxTW which is so characteristic of the repeats of the BNR family, pfam02012. It is unclear whether or not this unit is repeated throughout the sequences of this family, but if it is then the family is likely to be bacterial neuraminidase.
cd08978	GH_F	0.003	98	243	61	201	Glycosyl hydrolase families 43 and 62 form CAZY clan GH-F. This glycosyl hydrolase clan F (according to carbohydrate-active enzymes database (CAZY)) includes family 43 (GH43) and 62 (GH62). GH43 includes enzymes with beta-xylosidase (EC 3.2.1.37), beta-1,3-xylosidase (EC 3.2.1.-), alpha-L-arabinofuranosidase (EC 3.2.1.55), arabinanase (EC 3.2.1.99), xylanase (EC 3.2.1.8), endo-alpha-L-arabinanases (beta-xylanases) and galactan 1,3-beta-galactosidase (EC 3.2.1.145) activities. GH62 includes enzymes characterized as arabinofuranosidases (alpha-L-arabinofuranosidases; EC 3.2.1.55) that specifically cleave either alpha-1,2 or alpha-1,3-L-arabinofuranose side chains from xylans. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. GH62 are also predicted to be inverting enzymes. A common structural feature of both, GH43 and GH62 enzymes, is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller.
cd18607	GH130	0.008	97	190	8	103	Glycoside hydrolase family 130. Members of the glycosyl hydrolase family 130, as classified by the carbohydrate-active enzymes database (CAZY), are phosphorylases and hydrolases for beta-mannosides, and include beta-1,4-mannosylglucose phosphorylase (EC 2.4.1.281), beta-1,4-mannooligosaccharide phosphorylase (EC 2.4.1.319), beta-1,4-mannosyl-N-acetyl-glucosamine phosphorylase (EC 2.4.1.320), beta-1,2-mannobiose phosphorylase (EC 2.4.1.-), beta-1,2-oligomannan phosphorylase (EC 2.4.1.-) and beta-1,2-mannosidase (EC 3.2.1.-). They possess 5-bladed beta-propeller domains similar to families 32, 43, 62, 68, 117 (GH32, GH43, GH62, GH68, GH117). GH130 enzymes are involved in the bacterial utilization of mannans or N-linked glycans. Beta-1,4-mannosylglucose phosphorylase is involved in degradation of beta-1,4-D-mannosyl-N-acetyl-D-glucosamine linkages in the core of N-glycans; it produces alpha-mannose 1-phosphate and glucose from 4-O-beta-D-mannosyl-D-glucose and inorganic phosphate, using a critical catalytic Asp as a proton donor.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93743.1	0.0	1	789	2	795
AQT69995.1	2.69e-220	17	789	19	781
AQQ10394.1	3.10e-208	31	787	21	775
ARN56843.1	7.77e-206	31	787	21	776
AFN74218.1	5.70e-188	30	789	34	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	2.27e-73	447	787	24	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.64e-54	480	789	56	376	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.63e-45	480	789	39	359	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3K11_A	6.41e-18	425	789	18	415	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
1NC5_A	2.79e-12	456	742	17	312	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	1.52e-72	447	787	31	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
T2KPL9	1.57e-70	446	789	28	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
P9WF04	2.24e-66	428	784	29	408	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	1.53e-11	456	742	17	312	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000708	0.956747	0.041811	0.000267	0.000231	0.000213

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004281_02028.