CAZyme Information: MGYG000004259_01452

Basic Information

• Species: Atopobium minutum
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Atopobiaceae; Atopobium; Atopobium minutum
• CAZyme ID: MGYG000004259_01452
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
200	MGYG000004259_6|CGC1	21979.34	8.6244

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004259	1625916	MAG	China	Asia

• Gene Location: Start: 26890; End: 27492 Strand: -

Full Sequence      

MVFRSRLRFLRWFRVVPLLIMMVLAVFSAGFEALPASITRKVIAPVPWPQQVLESAGRHG
VDPYLVCAVIRCESGWNEKASSPAGAQGLMQLMPATAQELSEFGLVDASKYKATNLQDPA
TNIEYGCAYLAYLQKQLGSTDKVIAAYNAGIGTVRQWSSQANANADFKTAISYPETALYL
ERVHLAYADYQRLWPGGIGA

Enzyme Prediction     

No EC number prediction in MGYG000004259_01452.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	51	189	9.4e-29	0.8814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.53e-55	45	187	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	4.72e-44	45	193	3	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.01e-34	63	183	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.17e-30	52	168	1	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK11619	PRK11619	1.45e-26	45	192	476	625	lytic murein transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADK68420.1	5.94e-63	8	200	5	194
SDR81479.1	4.05e-61	8	198	5	192
QOY61251.1	2.13e-56	8	198	16	203
QIA32839.1	2.11e-55	8	195	5	189
ATP53198.1	1.71e-54	8	195	5	189

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1SLY_A	5.02e-19	68	196	473	603	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
1QSA_A	2.33e-18	68	196	473	603	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
5MPQ_A	5.49e-14	47	194	415	559	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	5.50e-14	47	194	419	563	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	5.51e-14	47	194	425	569	Lytictransglycosylase in action [Neisseria meningitidis MC58]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC4	1.29e-17	68	196	500	630	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P0AGC3	1.29e-17	68	196	500	630	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P39434	3.23e-17	68	196	500	630	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
O31976	1.77e-16	55	154	1429	1518	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
O64046	1.77e-16	55	154	1429	1518	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34