CAZyme Information: MGYG000004256_00659

Basic Information

• Species: CAG-177 sp003538135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp003538135
• CAZyme ID: MGYG000004256_00659
• CAZy Family: GH33
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438	MGYG000004256_2|CGC1	47133.84	5.0633

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004256	2314164	MAG	China	Asia

• Gene Location: Start: 35544; End: 36860 Strand: -

Full Sequence      

MKRFLALAIAALMILSCAACSSDGNGDTTAAEGTTAADTVSDVIAAPANDDTTAPSETAA
PAENGGNTASPAPADRNNNINIIIKPAGTAKPSAGGSSTVTPPKTDNTPVEVETDPKKII
VSAEKEWIFTEKITDSCHASTVLPLDDGSVIAAWFGGSSEKENDVNIYTSVRTEKDGWSK
PIVVSAAAEIAHWNPVLFQKEDGTVILYFKVGKDTDYWQTYYATSTDGRSWSTPKELVPG
DNSGGRGPVKNKPIRLKNGTVLAPASTEIDGKWKAFVDISTDDGKTWSKTSVIDSSFLGF
FKVPMIQPTLWESKDGSVHMLTRTKLGKIYRSDSLDGGKTWCRAYATNLPNNNSGIDLDT
DDSGRIFLAYNPVGIPGIRTPLVLSVSTDDGKTFTKIKTFEKGLAEYSYPAVVVKGDTIH
ITYTYERDYIAYWQIKVK

Enzyme Prediction     

No EC number prediction in MGYG000004256_00659.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	132	424	8.5e-31	0.9064327485380117

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13088	BNR_2	5.79e-91	148	421	1	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4692	COG4692	1.66e-53	137	432	33	368	Predicted neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd15482	Sialidase_non-viral	2.33e-53	134	428	11	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam15902	Sortilin-Vps10	4.24e-06	279	400	5	115	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACX65278.1	2.83e-102	125	438	8	326
AFC30937.1	3.34e-102	125	433	12	326
AEI43278.1	3.34e-102	125	433	12	326
AFH63259.1	1.07e-100	125	433	12	326
QTV77693.1	1.68e-98	124	431	2	326

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000005	1.000016	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004256_00659.