CAZyme Information: MGYG000004256_00228

Basic Information

• Species: CAG-177 sp003538135
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; CAG-177; CAG-177 sp003538135
• CAZyme ID: MGYG000004256_00228
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	MGYG000004256_1|CGC7	82010.05	4.7704

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004256	2314164	MAG	China	Asia

• Gene Location: Start: 248441; End: 250627 Strand: -

Full Sequence      

MNFGELFGSAEWVTCESGCTSPVIKGSFFIEKPERAEVTVCGLGFFRLWINGREVSEDKF
VPVNSQYCKRDLTAFEYPITDELSYRTYAVRYDISKFLVGGENDIRAVLGCGWFAQKKRN
AEGYTKYGDIKLCYKIDAEDRDGKLYTFVSDEKLLWRQSRITENNIYFGEAHDMDLSDEL
TARDGFKKVIKAPAHETEFFIQDCPADRVTRIIEPKKLADLGAVSVYDMGENISGYPVVA
ATEDGAYITVRCSEEINADGTLNFDSCDPGQIQCDEYRNAKKGEECMPWFTWHGFRYFEL
TNNAKPVRCEVVHSDCAVTSAFESDSEMLNWLYDAYIRTQLSNMHSGVPSDCPHIERLGY
TGDGQLCCEAAMMLLDSQKFYQKWLEDISDCQSTDNGHVQHTAPFMGGGGGPAGWGGAIA
VVPYEMYKIYGDRETFRRYLPKILRYFDYLDSRSSGGLVCREEQGGWCLGDWCTPEPIAI
CEPFVNTALCVKQMLMTKEAAEAIGEKETAQMLGRRIEEKRQAILNAYYSPQTGSFIGDV
QGANSFATNIGLGGERAYENTRKKYSAADSFDTGIFGTDILIRVLFERGDANTAFRLLTS
EGKGSFYNMKKQGATTIWENWDGERSHSHPMFGAATRYLFSFILGITQEKTSAGYEHILI
APQIPDGLNYASGHITTVRGKISVTFKRTESEADFYVTVPQRARFTYGSGCEFELRDGEN
HIHIDFEE

Enzyme Prediction     

No EC number prediction in MGYG000004256_00228.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	224	703	2.6e-117	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	8.57e-69	319	634	3	331	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	1.75e-23	32	211	2	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	6.56e-09	224	305	7	89	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	3.72e-08	652	700	6	54	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUS97255.1	2.39e-220	7	725	3	725
BCJ98018.1	3.39e-128	12	700	127	849
QOY86540.1	1.55e-127	33	700	164	833
QUT50058.1	3.10e-113	21	700	161	849
QBE96295.1	3.64e-109	10	700	124	823

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.52e-64	21	723	176	915	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	4.95e-55	31	724	314	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	4.14e-29	36	724	147	865	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	2.45e-54	31	700	195	897	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	2.59e-54	31	724	314	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	1.18e-51	36	700	190	869	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004256_00228.