CAZyme Information: MGYG000004253_00635

Basic Information

• Species: Desulfovibrio piger_A
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio piger_A
• CAZyme ID: MGYG000004253_00635
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MGYG000004253_8|CGC2	38810.45	8.3937

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004253	2386728	MAG	China	Asia

• Gene Location: Start: 62283; End: 63344 Strand: -

Full Sequence      

MPACPLVTVLLPVWNGASLPLTAGGEEPLRVAIRSLARQEPAPDAPVPSFEVLAVDDGST
DGTAALLDALAAEHPCLRVLHRPHEGLPGALNAGLAAARGALVARMDADDVCHPQRLALQ
AAWMAAHPGTGLLATRVHFGGDRETARGFAHFVDWQNGLLDHEAISRNRFRDTPVSHPSV
MFRRELPRLHGGYADGFFAEDWELWLRWLHAGVRMAKLPQELLVWNDPPRRATRSDSRYC
EAANNRLRALWLARWLERHNPWHPRVYLLGAGRVARRRLAPLWEKGVQVAAFVDIDPKKI
GQRVRGVPVIGRDGLPGPGRCFLLNALTAHGADEDAARWLAAAGYGPEQWLLA

Enzyme Prediction     

No EC number prediction in MGYG000004253_00635.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	26	184	3.5e-29	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04195	GT2_AmsE_like	1.68e-22	8	223	1	198	GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis. AmsE is a glycosyltransferase involved in exopolysaccharide amylovora biosynthesis in Erwinia amylovora. Amylovara is one of the three exopolysaccharide produced by E. amylovora. Amylovara-deficient mutants are non-pathogenic. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
pfam00535	Glycos_transf_2	1.13e-13	8	186	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	4.62e-12	5	286	3	262	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd00761	Glyco_tranf_GTA_type	1.80e-11	9	212	1	151	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
cd06433	GT_2_WfgS_like	7.06e-08	108	222	84	190	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SFV73829.1	1.52e-267	1	352	1	352
AMD91265.1	1.16e-154	3	353	5	346
VZH33410.1	5.73e-150	3	353	11	355
QTO40257.1	8.42e-150	5	352	14	355
SPD35648.1	1.96e-148	2	352	11	355

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	8.46e-09	5	207	13	182	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
3BCV_A	4.26e-08	5	110	5	95	Crystalstructure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3BCV_B Crystal structure of a putative glycosyltransferase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
2Z86_A	4.99e-07	5	119	375	474	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_C Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli],2Z86_D Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GlcUA and UDP [Escherichia coli]
2Z87_A	4.99e-07	5	119	374	473	Crystalstructure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli],2Z87_B Crystal structure of chondroitin polymerase from Escherichia coli strain K4 (K4CP) complexed with UDP-GalNAc and UDP [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q46635	1.00e-12	51	223	33	199	Amylovoran biosynthesis glycosyltransferase AmsE OS=Erwinia amylovora OX=552 GN=amsE PE=3 SV=2
Q48215	2.34e-10	29	223	18	200	Uncharacterized glycosyltransferase HI_1695 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1695 PE=3 SV=2
P71054	2.09e-09	5	222	5	203	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2
P55465	6.05e-09	5	207	366	547	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q4KXC9	2.46e-08	90	248	78	230	O-antigen biosynthesis glycosyltransferase WbnJ OS=Escherichia coli OX=562 GN=wbnJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004253_00635.