CAZyme Information: MGYG000004253_00482

Basic Information

• Species: Desulfovibrio piger_A
• Lineage: Bacteria; Desulfobacterota; Desulfovibrionia; Desulfovibrionales; Desulfovibrionaceae; Desulfovibrio; Desulfovibrio piger_A
• CAZyme ID: MGYG000004253_00482
• CAZy Family: GT11
• CAZyme Description: O-antigen biosynthesis glycosyltransferase WbnK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
295	MGYG000004253_6|CGC1	34512.83	8.5278

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004253	2386728	MAG	China	Asia

• Gene Location: Start: 9707; End: 10594 Strand: +

Full Sequence      

MSHITVQMCGGLGNQMFQYAMGRALSLRHHVPLILDISWFSGPMTGCTKRKYLLDIFPHI
ASSKDISYYNRYAIQKWKRIGKRILSYFFPAESTIIQPYFAYWPQIELVNPPAYLSGYWQ
SEKFFSPYTIKIKQDFTFPTLPEGEAIFLAQKIKSAPDSVAVHIRRGDYVTDKRAQSCHG
NIPLSFYKDALDYIKDIYGEITIFVFSDDPAWVKEYFDYRKNIPIIVNLNFSDHPYHDMH
LMSLCKHHVIANSTFSWWGAWLGTQQGLTIAPAQWFADEKFEKYKDIFCKEWIIM

Enzyme Prediction     

No EC number prediction in MGYG000004253_00482.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT11	4	293	6.2e-72	0.9855072463768116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11301	Fut1_Fut2_like	2.94e-64	4	281	3	261	Alpha-1,2-fucosyltransferase. Alpha-1,2-fucosyltransferases (Fut1, Fut2) catalyze the transfer of alpha-L-fucose to the terminal beta-D-galactose residue of glycoconjugates via an alpha-1,2-linkage, generating carbohydrate structures that exhibit H-antigenicity for blood-group carbohydrates. These structures also act as ligands for morphogenesis, the adhesion of microbes, and metastasizing cancer cells. Fut1 is responsible for producing the H antigen on red blood cells. Fut2 is expressed in epithelia of secretory tissues, and individuals termed "secretors" have at least one functional copy of the gene; they secrete H antigen which is further processed into A and/or B antigens depending on the ABO genotype. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
pfam01531	Glyco_transf_11	1.15e-25	112	293	123	295	Glycosyl transferase family 11. This family contains several fucosyl transferase enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHB87954.1	1.79e-62	4	295	2	293
QDC79075.1	1.79e-62	4	293	2	291
SDS34720.1	4.39e-59	4	295	2	288
QSF50456.1	7.16e-59	4	293	2	291
QEQ00180.1	2.02e-58	4	293	2	291

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q58YV9	1.46e-35	10	283	7	293	O-antigen biosynthesis glycosyltransferase WbnK OS=Escherichia coli OX=562 GN=wbnK PE=1 SV=1
Q866D9	2.17e-08	107	293	156	350	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Mico humeralifer OX=52232 GN=FUT1 PE=3 SV=1
Q866C9	2.92e-08	107	293	157	351	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Lagothrix lagotricha OX=9519 GN=FUT1 PE=3 SV=1
Q866E4	2.92e-08	107	293	157	351	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Alouatta caraya OX=9502 GN=FUT1 PE=3 SV=1
Q866E1	2.92e-08	107	293	157	351	Galactoside alpha-(1,2)-fucosyltransferase 1 OS=Alouatta belzebul OX=30590 GN=FUT1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004253_00482.