CAZyme Information: MGYG000004250_02568

Basic Information

• Species: Acetatifactor sp003447295
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor; Acetatifactor sp003447295
• CAZyme ID: MGYG000004250_02568
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
662	MGYG000004250_41|CGC1	75689.41	6.2491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004250	3091301	MAG	United Kingdom	Europe

• Gene Location: Start: 17305; End: 19293 Strand: -

Full Sequence      

MNLKDAAANLNQAHPEDILHPLFTPWGEMIMRSGSYDDILSEYPRPQMRRTDYHMQNGLW
EYAFVPADGSKASEDPAYFTAQGIIRVPFSPESLLSRVHRRLEPTEYLWYHRKLSFSTEE
LSQKEENMHCILHFDAVDQEATVFLGTKQLGIHSGGYLPFSLDITEYVNEDPVSLYVKVR
DLTDTGYATRGKQTLNRGGMFYTAQSGIWQSVWYEWVPENYVINYKITPEYNKASVTFVL
CSPKPFNHLEFRVNIPSCDGTLAQENTGSLTRMRVRKISEQQDSFGLTHTTVVLSFPASV
TYSAADPADAPEPVNFKPWSPEHPWLYPFTLTADGDTVEGYFAMRCYSVERDSKGIPRFC
LNHKPYFLHGILDQGYWSDGLMTAPCDEAFVYDISLAKGLGFNMLRKHIKIEPLRWYYHC
DRLGMIVWQDMVSGGSTYHMPWVCYMPTLFPHMSAHTKDNHYELFSRSSEEGRKSWEQEC
LDTIDHLYNVPSIAVWVPFNEGWGQFDAARIAKMVAKKDPTRPVDHASGWFDQKGGDFRS
IHNYFRPLQVKLDGKRAFVISEYGGYACHIDGHSSVDRVYGYQKYDTPEEMAAALKQLFS
RQLFPLISKGLSGAVYTQLSDVEEEVNGLVTYDRRIVKLPVGHPFAAPSSFAAPYSHGNK
PE

Enzyme Prediction     

No EC number prediction in MGYG000004250_02568.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	46	541	3.5e-80	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.67e-21	39	609	1	507	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	4.35e-17	57	524	16	445	beta-D-glucuronidase; Provisional
pfam02836	Glyco_hydro_2_C	5.52e-08	359	634	8	284	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	3.09e-07	57	212	5	163	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	0.006	315	345	71	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM02004.1	0.0	1	662	1	662
ADL32949.1	1.38e-228	1	639	1	627
AOZ95236.1	5.38e-227	1	639	1	626
QHQ59405.1	1.90e-211	1	639	1	588
CUH91999.1	5.12e-207	1	639	1	596

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	1.30e-114	24	639	14	570	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5UJ6_A	1.20e-13	109	431	79	377	CrystalStructure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],5UJ6_B Crystal Structure of Bacteroides Uniformis beta-glucuronidase [Bacteroides uniformis str. 3978 T3 ii],6NZG_A Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis],6NZG_B Bacteroides uniformis beta-glucuronidase 2 covalently bound to cyclophellitol-6-carboxylate aziridine [Bacteroides uniformis]
6D50_A	1.20e-13	109	431	87	385	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
6D8G_A	4.76e-13	109	431	87	385	D341AD367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii],6D8G_B D341A D367A calcium binding mutant of Bacteroides uniformis beta-glucuronidase 2 [Bacteroides uniformis str. 3978 T3 ii]
6D1N_A	8.38e-13	56	431	51	379	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	5.19e-11	109	501	106	430	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004250_02568.