CAZyme Information: MGYG000004238_01092

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Eggerthellaceae; Senegalimassilia
• CAZyme ID: MGYG000004238_01092
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
437	MGYG000004238_257|CGC1	48753.2	7.2615

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004238	1536711	MAG	United Kingdom	Europe

• Gene Location: Start: 1161; End: 2474 Strand: +

Full Sequence      

MNTQTYTQRAQARPRRRIAVVTMGVKLGDETRGYTRFRFLSEMLVEQGFDVDLITSSFQH
WEKAPRDTSKACYQGLPYNVVFIDEPGYTRNLDLQRILSHHVAAKNLREHFERTAGRYSL
IYSEIPPNDVARVCAEYATEHDVPYVADINDLWPEAMRMVVDIPVLSDVAFYPFARDAKR
VYQLLSGAVGTSEEYAARPAKDRTAPYPHATVYVGNDLAAFDEGAREHMADVQKPEGELW
AVYAGTLGASYDLATLIKAAALLEKRRAAHTARTTAAGTAKRHRPFPAVKVKILGDGPDR
QRLEELARQENAPVDFLGYQDHGSMAAWLRASDITVNSLVKSAVQSIVTKIGDYLASGKP
MINTGSSPEFRNKVTTDGFGLNVEAENPEALADVLEELARNPSLRKIMGARGRAVAEREF
DQRTSYLAIVNLLRNLM

Enzyme Prediction     

No EC number prediction in MGYG000004238_01092.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03794	GT4_WbuB-like	6.54e-44	44	421	27	382	Escherichia coli WbuB and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. WbuB in E. coli is involved in the biosynthesis of the O26 O-antigen. It has been proposed to function as an N-acetyl-L-fucosamine (L-FucNAc) transferase.
cd03801	GT4_PimA-like	1.27e-26	35	434	18	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.40e-19	35	437	19	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03808	GT4_CapM-like	1.53e-15	214	423	171	351	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
pfam00534	Glycos_transf_1	2.42e-15	242	413	6	156	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAK44128.1	1.23e-228	15	437	22	456
QOS67157.1	5.06e-226	7	437	3	429
ACV55985.1	2.25e-220	23	437	1	411
QTU85212.1	1.01e-190	23	437	1	402
AJC12291.1	6.57e-186	23	436	1	406

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004238_01092.