CAZyme Information: MGYG000004231_00135

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-382; UMGS882
• CAZyme ID: MGYG000004231_00135
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
660	MGYG000004231_1|CGC2	75697.7	5.0192

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004231	2685220	MAG	United Kingdom	Europe

• Gene Location: Start: 159936; End: 161918 Strand: +

Full Sequence      

MQKFQADWITNKDFCDLVPINVFHKEMEDVKIPENENYANKHILFRRTFSLPEFGKAVLR
LSADDYYKLYINGRFITQGPAPGYPFHYYYNEIDVTRYLNPGTNVIAIHTYYQGLVNRVW
VSADLRQGMACELYLDGNKTLESDESWKCAYHTGFSACGKFGYDTQFAEVYDAGAPECGF
SAPDFDDSTWENARFRKHADYVLFRQPTGLLQFEQVKPREIRKTDKGLFLDFGFEAVGYL
TFEASGKRGDTVLLHFGEELNDDGSVRYKMRCNCDYEEKFVLSGKPEDVLNEYDYKAFRY
AELEIPDGVAVKEDTVCFVVRHYPFSEVKHYTGKNERLKRIYKLCSDTIKYGVQECFVDC
PTREKGQYLGDVTIAGLAHASLTGDPAMIRKALENYAESTFICKGLMTVAPASLMQEIAD
YSLQFPFQVLWLYRFTGDKDFLRSMYPYVLGVCDFFAAYRRENGLIENVKAKWNLVDWPA
NLRDNYDFPLERPIGEGFHNVVNAFYVAMLGHVDEIAGILGETPTGLYESTKKAYIDAFY
DRDRHLFVDSIGSHHASFHSNVIALFGGIWTCEENKRAMIELIREKRLTCAGVYMAFFAL
YALKQCGETELMEELIADDGAWANMLSEGATTCFEAWGKDQKWNTSLFHPWASAPAVLLD

Enzyme Prediction     

No EC number prediction in MGYG000004231_00135.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	225	658	1.2e-82	0.8511904761904762
CBM67	33	194	1e-40	0.9034090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	3.52e-26	335	659	10	336	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	3.07e-14	56	194	5	151	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	9.56e-12	221	320	1	102	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam04685	DUF608	0.003	420	537	99	208	Glycosyl-hydrolase family 116, catalytic region. This represents a family of archaeal, bacterial and eukaryotic glycosyl hydrolases, that belong to superfamily GH116. The primary catabolic pathway for glucosylceramide is catalysis by the lysosomal enzyme glucocerebrosidase. In higher eukaryotes, glucosylceramide is the precursor of glycosphingolipids, a complex group of ubiquitous membrane lipids. Mutations in the human protein cause motor-neurone defects in hereditary spastic paraplegia. The catalytic nucleophile, identified in UniProtKB:Q97YG8_SULSO, is a glutamine-335, with the likely acid/base at Asp-442 and the aspartates at Asp-406 and Asp-458 residues also playing a role in the catalysis of glucosides and xylosides that are beta-bound to hydrophobic groups. The family is defined as GH116, which presently includes enzymes with beta-glucosidase, EC:3.2.1.21, beta-xylosidase, EC:3.2.1.37, and glucocerebrosidase EC:3.2.1.45 activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH20286.1	1.66e-208	1	659	2	667
AFH60330.1	2.70e-204	2	659	3	666
AVM43798.1	4.16e-201	2	649	73	722
QCT01521.1	5.99e-201	4	659	5	666
AYQ75662.1	4.16e-198	36	659	18	643

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.24e-19	2	639	143	809	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
2OKX_A	2.40e-17	225	659	436	872	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
4XHC_A	5.48e-09	219	656	87	535	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KM26	1.92e-27	214	656	593	1065	Bifunctional sulfatase/alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22250 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004231_00135.