CAZyme Information: MGYG000004224_00163

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; UBA1390; UBA1390
• CAZyme ID: MGYG000004224_00163
• CAZy Family: GH4
• CAZyme Description: Alpha-galacturonidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
463	MGYG000004224_3|CGC3	51536.57	4.7904

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004224	2221068	MAG	United Kingdom	Europe

• Gene Location: Start: 44669; End: 46060 Strand: +

Full Sequence      

MVIENGKATGIKIAYVGGGSRGWAWGLMSDLAVEESMNGTVSLYDIDFQAAKDNETIGNK
IKDTEGVKSVWKYEAVHTLQEALTGADFVIISILPGTFDEMQSDVHTPEKYGIYQSVGDT
TGPGGIVRALRTVPMFVTIAEAIRDYCPEAWVINYTNPMTLCVRTLYEVFPQIKAFGCCH
EVFGTQKLLTEALADVAGIQGVDRSEIKTNVLGVNHFTWLDSAYYHNRDLFPIYAEFAEK
YAEKGFQKVVHDNWMNKYFGCTHRVKFDLFRRYGLIAAAGDRHLAEFCPGTWYLRNPETA
AKWGFGLTPVSWRKEDLVRRKERSARLVSGEEHFKLNETGEEGVMQMKALLGLGTLVTNV
NIPNYGQQEGLPYGAVVETNAVFSGDSVTPVMAGGLPSEVLSLVARVSNNQETVIEGIFT
KDKELILDAFCNDPLVTCSLEEARALYQEMVENTKAYLEGWEL

Enzyme Prediction     

No EC number prediction in MGYG000004224_00163.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH4	12	192	4.4e-58	0.9888268156424581

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd05297	GH4_alpha_glucosidase_galactosidase	9.11e-162	11	451	1	423	Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases. linked to 3D####ucture
COG1486	CelF	1.31e-105	8	461	1	439	Alpha-galactosidase/6-phospho-beta-glucosidase, family 4 of glycosyl hydrolase [Carbohydrate transport and metabolism].
PRK15076	PRK15076	6.03e-76	12	461	3	430	alpha-galactosidase; Provisional
pfam02056	Glyco_hydro_4	3.79e-62	12	193	1	181	Family 4 glycosyl hydrolase.
cd05197	GH4_glycoside_hydrolases	2.40e-46	11	452	1	424	Glycoside Hydrases Family 4. Glycoside hydrolases cleave glycosidic bonds to release smaller sugars from oligo- or polysaccharides. Some bacteria simultaneously translocate and phosphorylate disaccharides via the phosphoenolpyruvate-dependent phosphotransferase system (PEP-PTS). After translocation, these phospho-disaccharides may be hydrolyzed by GH4 glycoside hydrolases. Other organisms (such as archaea and Thermotoga maritima) lack the PEP-PTS system, but have several enzymes normally associated with the PEP-PTS operon. GH4 family members include 6-phospho-beta-glucosidases, 6-phospho-alpha-glucosidases, alpha-glucosidases/alpha-glucuronidases (only from Thermotoga), and alpha-galactosidases. They require two cofactors, NAD+ and a divalent metal (Mn2+, Ni2+, Mg2+), for activity. Some also require reducing conditions. GH4 glycoside hydrolases are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADL69889.1	2.71e-234	1	463	1	463
AFK85236.1	1.28e-232	1	463	1	463
SNX53414.1	7.93e-231	7	463	7	463
ANX00783.1	7.97e-226	7	463	7	462
AGC67847.1	1.61e-225	7	463	7	462

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FEF_A	2.08e-161	11	452	6	437	Crystalstructure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_B Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_C Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis],3FEF_D Crystal structure of putative glucosidase lplD from bacillus subtilis [Bacillus subtilis]
5C3M_A	8.01e-24	11	458	5	434	Crystalstructure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_B Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_C Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus],5C3M_D Crystal structure of Gan4C, a GH4 6-phospho-glucosidase from Geobacillus stearothermophilus [Geobacillus stearothermophilus]
1S6Y_A	2.22e-22	11	458	8	437	2.3Acrystal structure of phospho-beta-glucosidase [Geobacillus stearothermophilus]
1OBB_A	3.89e-21	11	451	4	465	alpha-glucosidaseA, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8],1OBB_B alpha-glucosidase A, AglA, from Thermotoga maritima in complex with maltose and NAD+ [Thermotoga maritima MSB8]
3U95_A	4.16e-19	11	462	1	471	Crystalstructure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_B Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_C Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_D Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_E Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359],3U95_F Crystal structure of a putative alpha-glucosidase from Thermotoga neapolitana [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
I3VRU1	2.55e-233	1	463	1	463	Alpha-galacturonidase OS=Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) OX=1094508 GN=Tsac_0200 PE=1 SV=1
D3T426	1.06e-198	1	461	1	453	Alpha-galacturonidase OS=Thermoanaerobacter italicus (strain DSM 9252 / Ab9) OX=580331 GN=Thit_1733 PE=1 SV=1
A9KTB9	1.99e-192	1	463	1	466	Alpha-galacturonidase OS=Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) OX=357809 GN=Cphy_3396 PE=1 SV=1
P39130	1.40e-165	11	452	10	441	Alpha-galacturonidase OS=Bacillus subtilis (strain 168) OX=224308 GN=lplD PE=1 SV=2
P30877	2.31e-44	9	461	3	448	Alpha-galactosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=melA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004224_00163.