CAZyme Information: MGYG000004218_00057

Basic Information

• Lineage: Bacteria; Firmicutes; Bacilli; RF39; UBA660; CAG-605
• CAZyme ID: MGYG000004218_00057
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
736	MGYG000004218_1|CGC1	85359.13	8.3402

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004218	1405729	MAG	United Kingdom	Europe

• Gene Location: Start: 57249; End: 59459 Strand: +

Full Sequence      

MKKCDIIIPIYNAYGCLAPCIDSVIKNTDLENNRLILIDDKSPDKKVLPLLKKYANGKNI
ILLTNSVNKGFVGTVNKGMEYSKENDVLLLNSDTEVTKNWLEKIKKCAYSSEHIATVTPL
SNNATFASVPYCFEANDIPNGLTLDEMADKVEKSAMNLNMETPTGHGFCLYIKRSVLNEI
GLFDAETYGRGYGEENDFCFRAIDAGYQNVICDNTYILHKESQSFSDAKTELIKQGLEAL
SKRYPNYRNRLDLWCQTRKVSVIGNNLCYEFGKNQDKPNVLFVIHDFADIKNNIGGTSLH
VFDIIRNLRKYFNFHILTPENNHFKLYSYWANSEGYSTIVYPKVTQISEYPFFNSDYRKM
INEIIDKFNINIAHIHHLIGNYFDLFDVLKERKIYTIITLHDYYSICLRINKLYKNKEYC
NNPDIETCTECMENREVSCERTLNLIKKWQFYWHKYLKQCDYVICPSEAAKLEINRVYQD
ININVIEHGIDIKKKIGNLDIKDNDNNVAFVGAIGIHKGSNILRELVRTRKSNFFNIHLF
GKIDIPMNSRKNFVNHGRYVREELPSLLKKNNIKIVCLFSTWPETYSYTLTEAVASGVPV
IAFDFGAIAERIKKYNLGWVIPINAGVDEIIEKIRNIFGNPDEYSEIIKSINNYKIKTTK
AMALEYKEMYEANLKMSKEAKIDEKYIKEKIKDSNIEYGSVSYANYAWVFDTLKWKIISK
FKFPKFVKKMMGREND

Enzyme Prediction     

No EC number prediction in MGYG000004218_00057.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	5	115	7.7e-21	0.6529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03823	GT4_ExpE7-like	4.91e-33	352	672	79	357	glycosyltransferase ExpE7 and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. ExpE7 in Sinorhizobium meliloti has been shown to be involved in the biosynthesis of galactoglucans (exopolysaccharide II).
COG1216	GT2	1.33e-24	1	224	2	224	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd03801	GT4_PimA-like	7.04e-24	279	671	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd04186	GT_2_like_c	2.77e-22	6	221	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG0438	RfaB	1.23e-21	294	672	14	376	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNL40326.1	9.09e-192	5	670	4	676
QGT72879.1	1.02e-190	5	670	4	676
CBK67716.1	1.13e-187	1	670	13	690
QUT32101.1	3.01e-187	5	670	4	677
AIQ20837.1	6.75e-162	3	670	6	679

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	8.29e-06	5	104	8	105	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P46918	4.83e-06	5	367	11	355	Minor teichoic acid biosynthesis protein GgaB OS=Bacillus subtilis (strain 168) OX=224308 GN=ggaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004218_00057.