CAZyme Information: MGYG000004214_00437

Basic Information

• Species: UMGS902 sp900761025
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS902; UMGS902 sp900761025
• CAZyme ID: MGYG000004214_00437
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
190		21235.23	5.3169

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004214	2122522	MAG	United Kingdom	Europe

• Gene Location: Start: 37799; End: 38371 Strand: -

Full Sequence      

MNKFIKSLTVIFVIAALSILCGLAAAHFADRLDRARYPQKYTDIVEKYADVYKVPRDICY
AVIRTESGFDPTAVSSAGAVGLMQMMPATFADLTARTGDNYETGMLYDPDTSIRYGVYYL
SMLYARYGVWDTAFAAYNCGMGRVDGWIAEGKVDENGKLTGIPLEETANYVARVNRAIEK
YEKLYNNESK

Enzyme Prediction     

No EC number prediction in MGYG000004214_00437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	57	182	2.5e-31	0.8

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	1.54e-54	38	180	1	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	9.63e-49	36	184	1	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	1.02e-36	60	179	5	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
COG0741	MltE	2.34e-30	32	186	130	288	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
pfam01464	SLT	1.28e-29	47	150	3	105	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK41497.1	1.69e-43	2	185	7	188
QAT49510.1	1.66e-40	2	185	5	186
QPJ85893.1	1.38e-35	37	189	31	184
AYH39946.1	5.60e-35	2	185	13	194
QWT54455.1	5.64e-35	13	185	29	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	5.81e-14	25	174	395	548	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	5.82e-14	25	174	399	552	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	5.83e-14	25	174	405	558	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	5.84e-14	25	174	409	562	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	5.86e-14	25	174	415	568	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.23e-14	45	174	64	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	5.94e-12	37	174	1418	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	5.94e-12	37	174	1418	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
Q0I513	4.61e-11	39	189	186	360	Membrane-bound lytic murein transglycosylase C OS=Haemophilus somnus (strain 129Pt) OX=205914 GN=mltC PE=3 SV=1
B0UWE6	4.61e-11	39	189	186	360	Membrane-bound lytic murein transglycosylase C OS=Histophilus somni (strain 2336) OX=228400 GN=mltC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.204174	0.742413	0.047782	0.002648	0.001050	0.001914

TMHMM  Annotations     

start	end
7	29