CAZyme Information: MGYG000004213_00313

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873
• CAZyme ID: MGYG000004213_00313
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
742	MGYG000004213_5|CGC1	81404.05	5.3696

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004213	2847158	MAG	United Kingdom	Europe

• Gene Location: Start: 15593; End: 17821 Strand: +

Full Sequence      

MKLKSLLLSCSFAAVLTAQAAVPVYLDRSKPIEDRVEDALSRMTTEEKIAIIHAQSKFSS
AGVPRLGIPELWTDDGPHGVRPEVLWDEWDQAGWTNDSCIAFPALTALAATWDRDVSRLY
GKSLGEEARYRKKDVILGPGVNIYRTPLNGRNFEYMGEDPYLAAKMVVPYIKGLQSNGVA
ACLKHFALNNNEVNRHTSNVIVDDRALYEIYLPAFKEAVDSGVWSVMGAYNLYKDQHLCH
NQYILNDILKGEWGFDGAVISDWGGTHDTEQAIHNGLDLEFGSWTDGLSQGTNNAYDNYY
LAMPYLKLIKAGKVGTKELDEKARRVLRLMYRTVMDNNRPYGSLCSPEHSEAARHIGEEG
IVLLANRGNVLPMKLDGRKKVAVIGENAIKMMTVGGGSSSLKAKFEISPLDGLRKRLAGK
ADVVYARGYVGDTTGEYNGVTTGQNLADDRTPEQLIAEAVDVAKDADYVIFVGGLNKDNH
QDCEDSDRAGLELPYNQDAVIEALAAVNPNLIVVNISGNAVAMPWVDKVPAIVQAWFLGS
EGGNALASVLTGDVNPSGKLPMTFPARLSDVGAHAVGQYPGTPRNDGSNIVDIEYREGIF
VGYRWADKNKIQPLFPFGHGLSYTTFDYGKATIDKTEGSADDVFTVSIPVTNTGDRAGRE
IVQLYVSDLKTTLPRPVKELKGFKKISLEPGQTETVTFEISRDDLSYFDADKHAWVVDPG
KFEALVGASSRDIRSKVAFKVK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	280	5.6e-68	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	6.97e-133	1	735	2	759	beta-glucosidase BglX.
COG1472	BglX	2.56e-73	64	401	56	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	3.88e-72	361	603	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	4.57e-62	6	710	13	750	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.83e-36	65	329	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT89173.1	0.0	3	742	1	740
ALJ59796.1	0.0	3	742	1	740
QMI79977.1	0.0	3	742	1	741
QPH58875.1	0.0	3	742	1	741
QUT74223.1	0.0	1	742	1	741

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.28e-160	36	741	5	668	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	1.41e-120	39	733	8	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	1.97e-119	17	741	34	828	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]
3AC0_A	2.06e-119	36	742	6	837	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
2X40_A	2.68e-119	34	741	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	7.11e-276	3	740	6	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	7.00e-160	36	741	5	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
P27034	9.01e-148	36	738	2	807	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
Q5BFG8	2.46e-144	35	737	10	834	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
A1CA51	4.86e-119	36	742	6	830	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000395	0.998769	0.000273	0.000181	0.000183	0.000169

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004213_00313.