CAZyme Information: MGYG000004209_00521

Basic Information

• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella
• CAZyme ID: MGYG000004209_00521
• CAZy Family: GH1
• CAZyme Description: Aryl-phospho-beta-D-glucosidase BglH

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476		53986.49	4.6831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004209	2134494	MAG	United Kingdom	Europe

• Gene Location: Start: 171874; End: 173304 Strand: +

Full Sequence      

MAFRNDFLWGGATAANQCEGAYDVDGRGLANVDVAPHGPERYAVVSGQRKMLDFEDGYYY
PAQTGIDFYHHYKEDIALFAEMGFKTFRMSLAWTRIFPNGDETEPNEAGLAFYEDVFREC
QAHGIEPLVTITHFDCPIHLIKKYGGWRNRKLIDFYKNLATTIFTRYKGLVKYWLTFNEI
NMILHLPFMGAGLVFEEGENKEAVEYLAAHNELVASAWATKIAHEIDPEVKIGCMLAAGS
YYPYSCRPGDVRQAQLDNQDNYFFVDVQSRGYYPAYAVKKLERLGIDVGMTDEDREILAA
NTVDFISFSYYSTRCSAGADNPDVERTQGNAFAGAKNPYLQESQWGWAIDPLGFRITLND
LYDRYQKPLFVVENGLGAKDVVEEDGSINDDYRIDFLRQHIQTMRDAVTEDGVDLLGYTT
WGPIDLVSAGTGEMSKRYGFIYVDRDDAGNGTLKRSKKKSFDWYKKVIASNGEDLS

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	2	472	1.2e-144	0.9883449883449883

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK09589	celA	0.0	1	475	2	476	6-phospho-beta-glucosidase; Reviewed
PRK09852	PRK09852	0.0	3	476	4	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK15014	PRK15014	0.0	6	475	9	477	6-phospho-beta-glucosidase BglA; Provisional
COG2723	BglB	0.0	1	476	2	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09593	arb	0.0	1	476	4	478	6-phospho-beta-glucosidase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AZH68819.1	0.0	1	476	1	476
ATP54514.1	0.0	1	476	1	476
QWT17213.1	2.56e-296	1	475	1	474
BAM47861.1	4.09e-277	1	476	1	475
AEB07701.1	1.60e-276	1	476	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	1.74e-207	3	475	8	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
2XHY_A	1.80e-180	1	475	6	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]
4F66_A	2.64e-180	6	475	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	7.53e-180	6	475	10	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
3PN8_A	6.58e-176	6	475	10	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans],3PN8_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 [Streptococcus mutans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P24240	2.80e-219	3	475	4	473	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2
P40740	4.87e-202	3	475	8	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
Q46130	3.94e-185	1	475	5	471	6-phospho-beta-glucosidase OS=Clostridium longisporum OX=1523 GN=abgA PE=3 SV=1
Q48409	1.09e-182	3	475	4	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
Q46829	9.86e-180	1	475	6	479	6-phospho-beta-glucosidase BglA OS=Escherichia coli (strain K12) OX=83333 GN=bglA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000023	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004209_00521.