CAZyme Information: MGYG000004208_01763

Basic Information

• Species: CAG-485 sp900759795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900759795
• CAZyme ID: MGYG000004208_01763
• CAZy Family: GH88
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
688	MGYG000004208_37|CGC1	77975.99	6.1051

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004208	2882561	MAG	United Kingdom	Europe

• Gene Location: Start: 10646; End: 12712 Strand: +

Full Sequence      

MLNKIITAGAALLTCLAMQAVPVPQYESALDYCHGKVKKSLSELGRDGYDYTMMPRNIAP
DGGQWNLRKATADEWCAGFWPGVLWYDYEATKDPEIRKQAENYTASLEFLSRTPAFDHDL
GFLMFCSYGNAYRLTHNPKYRQIIISTADTLATLFNPKVGTILSWPRNVEMLGGHNTIMD
NMINLEMLFWAAKNGGSRDLYDIAVKHAETTMKYHFRPDYTSYHVAVYDSETGRFLKGMT
HQGYADDTMWARGQSWAIYGYTMVYRETGDSRFLDFAKKVTDVYLDRLPADFVPYWDFND
PQIPNTTRDASAAAVVASALLELQCYCEGAEKARYLEAAYRMINSLNTADYRSPAGRSSF
LDHSTGHRPAGSEIDYSIIYADYYYIEALNRLRELERRGTLARLVSGRIYPERADDIAFE
NELVGFRIYGPATQAKGEKAYGYDIFLKHPTQRQILEDLYRPETSPATWVKVDSLRNIDP
KLAEDYIASFSYHIDHGLGMDCYAVGQTLGAGTAAILYDGRIQFPWCYKEAEVLENGPER
FAVRLDFPTVEVGGTQITEHRLISLDAGSQLAHCQVWYDGLTQPTTVVAGFPRRDESKAV
MNVKKGYLGYADPTQGPDNGKAMLGLVMNNKVEKMAEDQGHILAYTTLSPGQKLDYYYGF
AWDRANDIRNMKEWSGYLSDFSRKKRGK

Enzyme Prediction     

No EC number prediction in MGYG000004208_01763.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	70	391	1.3e-124	0.9848024316109423

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16153	DUF4861	1.87e-66	405	686	114	377	Domain of unknown function (DUF4861). This family consists of uncharacterized proteins around 400 residues in length and is mainly found in various Bacteroides species. The function of this family is unknown. However, in many instances the domain lies upstream of a glycosyl hydrolase family, usually family 88, so it might be involved in carbohydrate binding.
pfam07470	Glyco_hydro_88	5.53e-17	52	267	8	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK69065.1	3.43e-184	2	396	1	399
QUT22828.1	4.86e-184	29	396	30	399
QUT28605.1	6.89e-184	29	396	30	399
QUR43675.1	1.96e-183	29	396	30	399
QIU95298.1	2.77e-183	29	401	30	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.31e-86	31	397	30	393	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
1VD5_A	8.14e-54	74	392	41	364	CrystalStructure of Unsaturated Glucuronyl Hydrolase, Responsible for the Degradation of Glycosaminoglycan, from Bacillus sp. GL1 at 1.8 A Resolution [Bacillus sp. GL1],2D5J_A Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2D5J_B Unsaturated Glucuronyl Hydrolase Triggers Hydration of Vinyl Ether Group but not of Glycosidic Bond [Bacillus sp. GL1],2FUZ_A UGL hexagonal crystal structure without glycine and DTT molecules [Bacillus sp. GL1]
2AHF_A	4.14e-53	74	392	41	364	ChainA, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHF_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_A Chain A, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2AHG_B Chain B, unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV0_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_A Chain A, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1],2FV1_B Chain B, Unsaturated glucuronyl hydrolase [Bacillus sp. GL1]
2ZZR_A	3.46e-46	74	391	67	388	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	3.54e-46	74	391	68	389	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	3.41e-79	67	395	69	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q9RC92	4.46e-53	74	392	41	364	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1
Q8DR77	8.88e-50	74	391	66	387	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	1.94e-45	74	391	68	389	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	3.75e-45	74	391	69	390	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000232	0.999154	0.000152	0.000159	0.000145	0.000136

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004208_01763.