CAZyme Information: MGYG000004208_01760

Basic Information

• Species: CAG-485 sp900759795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900759795
• CAZyme ID: MGYG000004208_01760
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
629	MGYG000004208_37|CGC1	71031.6	7.2887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004208	2882561	MAG	United Kingdom	Europe

• Gene Location: Start: 4804; End: 6693 Strand: +

Full Sequence      

MGMILLAVVTAAGQSIYPGQHKGKIVVENRVQGRAKAFDLKNVRLLPGRVHDNVARDSVW
MSNISASRMTHSFKNNAGVFAGREGGYEAVKKYGGWESLDCDLRGHTTGHLMSAYGLMYA
TTGDPKFKAKGDSIVATLGEVQDVLGGGYLSAYPEELINRNLKGKGVWAPWYTLHKIMGG
LIDQYLYADNTQALEIARKMGDWAYGKLINQTEETRQLMLRNEFGGMNEAFYNLYSVTGD
ERYKKLGEYFYHNAVIDPLAQGDTDFGTKHTNTFIPKVIGEMRNYELTGSPRSLGIANLF
FDEMLDKHAFVTGEISQKEHYFDPAKMSKFLNGYTGETCCTYNILKLARHMFCNDADPKT
AEFYERALYNHILAQQDTESGMVCYFLPMLTGAYKVFSTPEQSFWCCVGSGFESQAKYAE
SIYFKGDNELFVNLFIPSEVNWAEQGLKVKQTTEFPNEETTLFQIEEAPAQAMKISLRYP
EWSGKPEVKVNGKKVVVKGKPSSYITLDRKWQRGDRIEVRYPMSLRVETTPDDPTRGALL
YGPVVLAGDLGTEGIKNNAFSDPTVRNDYYTYDYAIPEGLQTTLEIDPKNPGKKVTRTGK
NLVFEYNGQKIRPLYDTNHTRYVVYWNLK

Enzyme Prediction     

No EC number prediction in MGYG000004208_01760.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	42	547	8.3e-187	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	42	547	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	7.29e-103	93	551	55	505	Uncharacterized conserved protein, DUF1680 family [Function unknown].
cd04792	LanM-like	0.007	180	274	600	704	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ62034.1	5.77e-294	12	628	20	638
QUT92215.1	4.71e-293	12	628	20	638
QUU00179.1	3.84e-292	12	629	20	639
QUT34119.1	3.84e-292	12	629	20	639
QUT28595.1	6.09e-291	1	629	7	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	2.79e-106	38	626	28	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	2.61e-101	38	626	28	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
4QJY_A	1.33e-19	112	545	83	558	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.91e-18	112	545	83	558	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	2.20e-14	121	549	85	547	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.502046	0.497040	0.000421	0.000184	0.000151	0.000153

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004208_01760.