CAZyme Information: MGYG000004207_01587

Basic Information

• Species: UBA6398 sp003150315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp003150315
• CAZyme ID: MGYG000004207_01587
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
236	MGYG000004207_15|CGC1	26890.53	10.3392

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004207	2302618	MAG	United Kingdom	Europe

• Gene Location: Start: 1283; End: 1993 Strand: +

Full Sequence      

MFLIKSILKHIAIWIIVGFFASSIGMVFVYKVMPVYVTPLMVIRLFQQHAKGEKLKLHHQ
WVPLEDISKNLPVAVVASEDQLFMKHHGFDLKQIQDAAFDRIEGKRKRGGSTISQQTAKN
VFLWPTSSWVRKGFEAYFTVLIEFVWGKKRIMEVYLNSIEMGNGIYGAESVAKRHFHTDA
ANLSKSECALIAATLPNPLRFDSSNPSPYINKRKTAILGQMRNVKPLLQPLFNEAE

Enzyme Prediction     

No EC number prediction in MGYG000004207_01587.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	57	221	7e-52	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	3.78e-114	8	224	8	226	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	2.03e-85	11	224	4	221	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
COG0744	MrcB	5.13e-67	1	235	8	254	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
pfam00912	Transgly	1.35e-65	58	222	12	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	2.19e-33	1	221	2	230	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QFQ12129.1	4.84e-93	14	225	16	227
VEH15611.1	1.55e-88	5	222	2	220
BCI62313.1	6.93e-88	6	227	2	223
APW32118.1	7.66e-88	3	224	1	222
ATV38415.1	7.66e-88	3	224	1	222

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	1.82e-23	61	235	22	197	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	2.55e-23	61	235	22	197	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
3HZS_A	1.88e-19	46	235	4	204	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus MW2]
6FTB_A	1.91e-19	46	235	5	205	Staphylococcusaureus monofunctional glycosyltransferase in complex with moenomycin [Staphylococcus aureus MW2]
5ZZK_A	2.69e-19	54	235	52	240	ChainA, Monofunctional glycosyltransferase [Staphylococcus aureus subsp. aureus Mu50]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q3V7G2	1.17e-87	15	234	13	231	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
Q3V815	1.17e-87	15	234	13	231	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q8A8H2	2.71e-86	4	235	7	236	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V7R3	1.86e-64	19	226	19	226	Biosynthetic peptidoglycan transglycosylase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIMB 9529 / HD100) OX=264462 GN=mtgA PE=3 SV=1
B8GYX9	1.45e-61	4	217	5	212	Biosynthetic peptidoglycan transglycosylase OS=Caulobacter vibrioides (strain NA1000 / CB15N) OX=565050 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
13	35