CAZyme Information: MGYG000004207_00730

Basic Information

• Species: UBA6398 sp003150315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp003150315
• CAZyme ID: MGYG000004207_00730
• CAZy Family: GH3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
818		90550.23	7.6657

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004207	2302618	MAG	United Kingdom	Europe

• Gene Location: Start: 160572; End: 163028 Strand: +

Full Sequence      

MKLRVITVGFICACGVLFSHAQTPVEITTKDINRAKELVSKMTLDEKLSLISGNDDGMSL
RPIKRLGIPALQMHDGPQGIGQGIKGIMFPCGMLTAATWDRSMAKLVGESLATDFKNHNT
DVILGPGVNIYRATLCGRNFEYFGEDPFLASETAKQYILGVQSKGVIATIKHFAANNMEW
GRMDVNSNVDLRTLNEIYLTTFRKAVKEAKVGAVMDSYNLLYGLHTTESRYLNIDLLRKK
WGFQGIVMSDWGAVHSTVATANGGLDLEMPNSDFWKPEKVKEALAKGLISEATINEKVQH
ILQTMSAFGVLDKDESKKAVPHEMPELKAAALKIAESGITLLKNEDDVLPIAKQKFAVIG
PNADKIARGGGSGQVNYYSAVTPWAGIKKAFGKQASFISDSKYKTQLKNAFFTDASMSHP
GFKAEYFKNKKLEGEPALTRTEENPSIANDTKMPEGFTNANFSVRWSGVFKAQKDAAINF
IITGDDGYRLIIDGKTVCNEWRDQAAKKASYKLNAKAGKTYNVAIEYYQGTGDQKFELDL
FEYDLNKLGNILKDFNTAVVMVGYDTDTESEGSDRTFDLPDPQNELICNVASKVKNVIVV
ANSGGGFNFMPWIYNVKGVIMAWYPGQEGGTALANILKGTVNPSGKLPMSIEKKWEDNPV
HDNFFSKNGEKEITYQEGLFYGYRGYDAQNKRPLFPFGFGLSYTTFSYSDIKAQPLGKNR
LRVTFKVTNTGKRAGAEVAELYVCPLKSKVVRPVKELKGYEKVYLEKGASKTVTIDLNED
AFSYYDVETEDLVPDNGNFRILVGPSYDDLSLQTDVNF

Enzyme Prediction     

No EC number prediction in MGYG000004207_00730.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	63	270	2.3e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.08e-78	37	804	40	751	beta-glucosidase BglX.
COG1472	BglX	5.74e-66	65	381	57	379	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	6.54e-46	34	775	52	740	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.24e-45	339	703	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	5.25e-42	65	302	63	314	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72363.1	1.94e-266	1	816	1	815
QMI78847.1	8.65e-266	1	816	3	818
QBJ17291.1	2.46e-265	1	816	3	818
QGT72378.1	4.45e-265	1	816	1	815
QUT99859.1	1.98e-264	1	816	3	818

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	1.47e-135	36	816	6	666	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
3AC0_A	3.69e-132	36	810	7	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]
3ABZ_A	1.24e-128	36	810	7	828	Crystalstructure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_B Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_C Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus],3ABZ_D Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus [Kluyveromyces marxianus]
5WAB_A	8.56e-112	39	811	9	656	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
4I3G_A	2.74e-102	33	817	52	827	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5BFG8	4.22e-148	31	816	7	836	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P27034	4.67e-142	37	817	4	809	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A1CA51	1.18e-136	36	810	7	822	Probable beta-glucosidase I OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglI PE=3 SV=1
P14002	8.03e-135	36	816	6	666	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
A1DFA8	1.47e-133	36	810	7	822	Probable beta-glucosidase I OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000680	0.729164	0.269330	0.000258	0.000291	0.000241

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004207_00730.