CAZyme Information: MGYG000004207_00199

Basic Information

• Species: UBA6398 sp003150315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp003150315
• CAZyme ID: MGYG000004207_00199
• CAZy Family: GH65
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674		75569.39	7.0148

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004207	2302618	MAG	United Kingdom	Europe

• Gene Location: Start: 222087; End: 224111 Strand: -

Full Sequence      

MRNILLSLFLLLVCAFKADCQSLDGWTLSTRSRDNYAGISLANGRIGIVTSNLLFGVKHI
LLNGVYDRQNGFSGVSNAVFAPNFLNLTIHVDGREVKDNDATNWEQTLDMRNAQAVTQFD
TPDAHFRYTQQALRNAPFMAMTVVEITPNRDFELEAINQTVVSSPNKDAEYNFQRITDGP
ESIPLYSVRCNTRHNLHQVAVCSSFITRGQKHSATVGETQSNGTCALGLKTRLKTGETYS
FALAGAACTTRDFKNPANESARLVINISCQGVKRYMEEHVKEWARLWQSDIQIEGDVQSQ
TDVRSCLYHLYSFVGEDNRLSPSPMGLSSDGYNRHVFWDTEIWMYPPLLMLNQQMAKSCM
DYRIDRIPQAQNRARMYGYRGVMFPWESDDSGEEACPVWALTGTLEQHITADIAIAAWNY
YCVTKDREWLRTSGYPLISQAADFVASRMHKNSDGSYSFLNVVGADEYACNVDDNAYTNG
TAQVCLKYARQAARAVGEKPRKQWEEIENNIRYHYFADGVMREHATYNGQTIKQGDVVLL
AYPLGIMTDAAEIRKNLDYYDRVMDSKGPAMGSSILSILCSQLGDSEKAFRLWQRSYIPH
KCPPFGVLSEGAGGNNPYFATGAGGMLQAVLCGFGGLRITEHGIVQKFPCLPKQWTRLTI
TGVGPDHKTFVVKR

Enzyme Prediction     

No EC number prediction in MGYG000004207_00199.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH65	304	641	2.7e-99	0.9946236559139785

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1554	ATH1	2.90e-108	40	658	31	718	Trehalose and maltose hydrolase (possible phosphorylase) [Carbohydrate transport and metabolism].
pfam03632	Glyco_hydro_65m	1.22e-66	307	641	4	384	Glycosyl hydrolase family 65 central catalytic domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. The central domain is the catalytic domain, which binds a phosphate ion that is proximal the the highly conserved Glu. The arrangement of the phosphate and the glutamate is thought to cause nucleophilic attack on the anomeric carbon atom. The catalytic domain also forms the majority of the dimerization interface.
PRK13807	PRK13807	3.35e-51	40	659	30	708	maltose phosphorylase; Provisional
pfam03636	Glyco_hydro_65N	9.98e-09	40	241	18	231	Glycosyl hydrolase family 65, N-terminal domain. This family of glycosyl hydrolases contains vacuolar acid trehalase and maltose phosphorylase.Maltose phosphorylase (MP) is a dimeric enzyme that catalyzes the conversion of maltose and inorganic phosphate into beta-D-glucose-1-phosphate and glucose. This domain is believed to be essential for catalytic activity although its precise function remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUP80081.1	1.46e-225	9	674	7	674
AWX45602.1	1.64e-220	13	673	5	678
AXT56849.1	1.94e-220	3	673	8	683
QZE15002.1	5.19e-215	1	673	2	682
ARV06882.1	5.01e-214	1	673	1	676

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7FE3_A	1.10e-187	24	672	22	676	ChainA, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE3_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_A Chain A, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_B Chain B, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101],7FE4_C Chain C, Candidate alpha glycoside phosphorylase Glycoside hydrolase family 65 [Flavobacterium johnsoniae UW101]
3WIQ_A	1.11e-53	270	658	273	714	Crystalstructure of kojibiose phosphorylase complexed with kojibiose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_A Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_B Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_C Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903],3WIR_D Crystal structure of kojibiose phosphorylase complexed with glucose [Caldicellulosiruptor saccharolyticus DSM 8903]
4KTP_A	6.37e-37	61	663	58	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTP_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
4KTR_A	6.37e-37	61	663	58	714	ChainA, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_B Chain B, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_C Chain C, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_D Chain D, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_E Chain E, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_F Chain F, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_G Chain G, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10],4KTR_H Chain H, Glycoside hydrolase family 65 central catalytic [[Bacillus] selenitireducens MLS10]
1H54_A	4.68e-35	249	667	264	718	ChainA, Maltose Phosphorylase [Levilactobacillus brevis],1H54_B Chain B, Maltose Phosphorylase [Levilactobacillus brevis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q54KX5	8.91e-85	35	672	36	659	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Dictyostelium discoideum OX=44689 GN=pgghg PE=3 SV=2
Q8L163	5.80e-57	249	659	268	733	Kojibiose phosphorylase OS=Thermoanaerobacter brockii OX=29323 GN=kojP PE=1 SV=1
Q8BP56	6.68e-57	279	664	230	627	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Mus musculus OX=10090 GN=Pgghg PE=1 SV=1
F1NZI4	3.88e-56	279	664	241	638	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Gallus gallus OX=9031 GN=PGGHG PE=1 SV=3
A0JMP0	6.90e-56	279	663	186	585	Protein-glucosylgalactosylhydroxylysine glucosidase OS=Danio rerio OX=7955 GN=pgghg PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000193	0.999220	0.000172	0.000144	0.000132	0.000128

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004207_00199.