CAZyme Information: MGYG000004207_00027

Basic Information

• Species: UBA6398 sp003150315
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; UBA6398; UBA6398 sp003150315
• CAZyme ID: MGYG000004207_00027
• CAZy Family: GH78
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
606		67265.03	7.6689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004207	2302618	MAG	United Kingdom	Europe

• Gene Location: Start: 36839; End: 38659 Strand: -

Full Sequence      

MTNFFKIFCLTSAALLTMPATAQNCTPGADKSKCCTVKCGESSIPALKGISMQTDRRVIS
YILPKRIMWKQSTGGSTMENEGFLLKNNYGQTALGGISFCHLKNGKGGMNSMLFDFGAEL
QGGIQVVTGGAPANKVKLRVRFGESASEAMCEIDGKNGATNDHALRDFTLEVPGMGVAEC
GNSGFRFVRIDVLGDETDLQLQEVRAAFRYRDIPYLGSFECDNERLNKIWTTGAYTVHLN
MQQYLWDGIKRDRLVWTGDINPEVLTIATVFGANDVVNKSLDLSKENFKPTQWMCTLSSY
SIWWMITHYQWYMYTGNRKYLDEQKDYVTELLGELMKYVDDKGYEKLNARFLDWPSSENP
KGIDAGLQALMAIAFDSGAKLETIWGNTELAKKCSDIFAKMKKCRRDFNGSKQAASLNAI
AGMISPEKAAKKTILPGGAKDFSTFYGYYMLEALALAGYYTEAMDIMSQYWGAMLDLGAT
TFWEDFNLDWTKNAARIDELVPEGKVDIHSSYGNYCYKGFRHSLCHGWASGPTTWLSAHV
LGVKVLEPGCKKVAIEPHLGNLKWAKGTFPTPYGVIKISHKVGADGKVISDVQAPQGVEI
VKSETK

Enzyme Prediction     

No EC number prediction in MGYG000004207_00027.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	111	599	7.2e-102	0.9742063492063492

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.82e-16	217	540	4	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.83e-07	542	599	1	58	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT19201.1	6.32e-234	51	600	19	580
BBK91321.1	8.96e-234	51	600	19	580
QIX67104.1	8.96e-234	51	600	19	580
QUR50485.1	1.80e-233	51	600	19	580
QUT54421.1	1.87e-233	51	600	19	580

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	5.51e-47	112	597	194	688	Crystalstructure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2OKX_A	8.75e-30	184	600	504	937	Crystalstructure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]
6I60_A	3.08e-10	113	579	365	874	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
6GSZ_A	5.17e-10	113	575	329	811	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]
4XHC_A	9.04e-10	110	541	93	543	ChainA, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000614	0.998449	0.000337	0.000217	0.000179	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004207_00027.