CAZyme Information: MGYG000004203_01271

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Acetatifactor
• CAZyme ID: MGYG000004203_01271
• CAZy Family: GH18
• CAZyme Description: Chitinase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
498		55311.86	3.9531

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004203	2860639	MAG	United Kingdom	Europe

• Gene Location: Start: 64221; End: 65717 Strand: +

Full Sequence      

MKWKKIMAACLTLSVVLAGCGKTEPATAQTESTGEQTQESAPEETKETEEETTVDETSGE
DVETESTGDKQVVVYFANWYLGEKAADQGAEVASIPWDKVTYINHAFWGVVPADGTTETS
VERRASGEGARTEFKIVSTAPDKDYEDTTPSDMRPDIARNHFAEYAAYSEQYPDVNIMLS
IGGWTACGYFSEMAYTEEGRQSFIKSCLDVMDQYEWIDGIDIDWEYPGGSKDGERAPESD
IDQGCPIFGTAKEDNVNFATLLSELRDAMDEHFGEGAKRLTACASASTSWTLPMQDWASF
APYLDLINVMTYDLAGVWDATTGHASSAWSAKSAASYFKGLGIELDKVCIGSPMYATALA
MKEIPASGNVLGAAIEDYKPNETAIDETQMRAFEEEALSGFTVKQDGKTWVMGDSFEEEG
TGWHFAYDEKKNACYMYNDCEDSPYYKWYISYENHLSLQAKLDYINEKDLAGIIVWECSE
DTYDHEFISQMADNLITE

Enzyme Prediction     

EC	3.2.1.14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	70	487	4.2e-60	0.956081081081081

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06548	GH18_chitinase	1.10e-67	72	481	1	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
smart00636	Glyco_18	1.55e-53	71	477	1	330	Glyco_18 domain.
COG3325	ChiA	4.12e-52	72	481	40	423	Chitinase, GH18 family [Carbohydrate transport and metabolism].
pfam00704	Glyco_hydro_18	6.77e-52	71	481	1	307	Glycosyl hydrolases family 18.
cd02872	GH18_chitolectin_chitotriosidase	3.70e-37	156	483	52	352	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUA53259.1	6.38e-103	72	495	33	402
QTE75743.1	7.17e-102	72	495	33	402
QTE71783.1	7.17e-102	72	495	33	402
QTE68039.1	1.43e-101	72	487	33	392
QUC67499.1	2.85e-101	72	495	33	402

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6JM7_A	2.85e-29	152	483	53	352	Crystalstructure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis],6JMB_A Chain A, ofchtiv-allosamidin [Ostrinia furnacalis]
6JM8_A	3.43e-28	152	483	53	352	Crystalstructure of Ostrinia furnacalis Group IV chitinase [Ostrinia furnacalis]
6INX_A	1.43e-27	173	477	61	325	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6BT9_A	2.70e-27	70	481	37	448	ChitinaseChiA74 from Bacillus thuringiensis [Bacillus thuringiensis],6BT9_B Chitinase ChiA74 from Bacillus thuringiensis [Bacillus thuringiensis]
6IGY_A	1.28e-26	62	495	8	376	Crystalstructure of Aspergillus niger chitinase B [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P32823	4.23e-28	75	495	163	585	Chitinase A OS=Pseudoalteromonas piscicida OX=43662 GN=chiA PE=1 SV=1
Q95M17	5.01e-24	157	490	69	374	Acidic mammalian chitinase OS=Bos taurus OX=9913 GN=CHIA PE=1 SV=1
P20533	1.67e-23	65	481	39	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
P36909	3.37e-23	57	482	227	595	Chitinase C OS=Streptomyces lividans OX=1916 GN=chiC PE=2 SV=1
C5P230	1.65e-22	63	486	31	388	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000073	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004203_01271.