CAZyme Information: MGYG000004188_02186

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004188_02186
• CAZy Family: GH141
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
713	MGYG000004188_18|CGC1	81230.49	6.8076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004188	3351981	MAG	United Kingdom	Europe

• Gene Location: Start: 45332; End: 47473 Strand: +

Full Sequence      

MKKTITTLCLCLSIHTGMQADETVYLSPAGNDLGKGTAESPYYSLNKAIENRLTGKAADD
TLFIRVMEGTYHMKAPFRIEQANSRPVVILADNPQAKPVFSGGITVGGWEKYGDKLYRAY
IPEVVQYGTNFEQLYVNGTRAVLARTPNDGWYYVDGTSETQFTPGVRYADYAVQRINFRP
EDWKTIKGKQTDELSHLKFRFYHKWDITLQKATYVEPDSAFIYMQGKGMRPWNPIRKGSR
YVMYDYMAALDMPGEWFLDRKEGYLYYMPRPEEQMETAECFIPLLSQLVTVKGSKQGVVK
GVSFRNIVFSHTLHNMPEQGEDPFQAAAPVEAALSFDYAENISLYNCEVSHTGGYGIWFR
QACHHNRIEHCLLSDLGAGGIKIGEPYFRDDPTMISSHNTVDNNIIVHAGRELPCGVGVA
IFHSSDNRVTHNEIADLYYSGISVGWVWGYNQSPLLWTMHVNLRGEVEYLQKELTNPAVR
NLIAYNHIHHIGWGELSDMGAVYTLGESEGTVITHNVIHDVLTYDYGGWGLYTDEGSTGV
TMTNNLVYRCKSGGFHQHYGKENRIENNIFAFGHYFQAQYTRPEEHLSFHFRHNIILQER
GATLSGAWEKGRTDMDYNLYWHLNGSPTFGKQSFKEWKKSKEPHSICADPLFKDPQNDDY
SFASKRNIRKIKFRPFDSSAAGVYGEASWKKQAQLSPEVLEAFEQRAKTILKD

Enzyme Prediction     

No EC number prediction in MGYG000004188_02186.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH141	23	548	1.2e-104	0.9905123339658444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13229	Beta_helix	6.75e-15	332	568	1	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	2.59e-08	418	570	2	110	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam13229	Beta_helix	1.33e-07	331	432	69	156	Right handed beta helix region. This region contains a parallel beta helix region that shares some similarity with Pectate lyases.
pfam05048	NosD	5.87e-06	330	444	40	136	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.
pfam05048	NosD	8.77e-05	338	580	26	181	Periplasmic copper-binding protein (NosD). NosD is a periplasmic protein which is thought to insert copper into the exported reductase apoenzyme (NosZ). This region forms a parallel beta helix domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA25764.1	9.42e-205	3	705	2	684
AKP49975.1	2.51e-199	23	708	37	708
SCM58138.1	3.19e-197	10	703	9	697
AEL24383.1	1.66e-194	23	713	37	714
EAR00018.1	7.65e-192	1	704	1	690

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQP_A	5.21e-50	24	545	27	580	Glycosidehydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_B Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_C Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_D Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_E Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_F Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_G Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron],5MQP_H Glycoside hydrolase BT_1002 [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000469	0.998605	0.000340	0.000200	0.000190	0.000180

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004188_02186.