CAZyme Information: MGYG000004188_00190

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004188_00190
• CAZy Family: PL38
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000004188_1|CGC6	73859.72	7.4642

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004188	3351981	MAG	United Kingdom	Europe

• Gene Location: Start: 256903; End: 258831 Strand: -

Full Sequence      

MKKFILLLVVLCACMLGLKAETKVIPVIQVTSVWDMEHLAKVKKQIRKPFYAASYEALLQ
EADGWLKQEPLSVMMKKQVPASGDKHDYMSIARYYWPDPSKPNGLPYINKDGEVNPEIFD
YDRYPLGQMVDRVIALTLAWYFSGEERYAAEATKQVRVWFLDKATCMNPNLEYSQVVMGK
DNNKGRSSGLIDTYSFIEMLEAVTLLEKSRSFTEADSKALKAWFEQLTEWMLTSPQGKKE
AASANNHSVSYDTQIITFALYSGNRKLAEETIKAFPEKRLFRQVEPDGSQPQELRRTLAF
HYSRENLTHVINIMLMAKRAGLPIDRLESADGRSFYKAIDFLTPYVEKGQEAWPYQQISG
WDGEVQSFCKDLYRIASCLNPAKKEEYLRLFRSHHVYHLKDRFNLLFLDEDLLAGCSPKV
ILKLDDLSVKNHICSCASVMDVLKRRGISASFGIIMQRCDATLQSSLRPYMQAKDAEGNR
LFEFWHHGYDHKRPEFGGASYEHQKRHFELADSLGKAMLGVELTTFGAPFNQVDSLTARV
IQENGNYRYVFFANERLFQGSDVCLLNNRINMEDGTGKVDYKYFLKNYKAGGAVEKPYIV
LQGHPNQWDEQRIKEFVQIIEFLQKEGCEFVLPSQMDVMTKL

Enzyme Prediction     

No EC number prediction in MGYG000004188_00190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL38	73	350	1e-104	0.989247311827957

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	2.44e-92	72	353	1	274	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd10927	CE4_u3	1.43e-57	418	635	3	226	Putative catalytic domain of uncharacterized bacterial proteins from the carbohydrate esterase 4 superfamily. This family corresponds to a group of uncharacterized bacterial proteins with high sequence similarity to the catalytic domain of the six-stranded barrel rhizobial NodB-like proteins, which remove N-linked or O-linked acetyl groups from cell wall polysaccharides and belong to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10918	CE4_NodB_like_5s_6s	4.24e-08	442	575	20	157	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
COG0726	CDA1	1.33e-07	439	631	83	251	Peptidoglycan/xylan/chitin deacetylase, PgdA/CDA1 family [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
cd10925	CE4_u1	0.003	419	546	1	142	Putative catalytic domain of uncharacterized bacterial proteins from the carbohydrate esterase 4 superfamily. This family corresponds to a group of uncharacterized bacterial proteins with high sequence similarity to the catalytic domain of the six-stranded barrel rhizobial NodB-like proteins, which remove N-linked or O-linked acetyl groups from cell wall polysaccharides and belong to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT37272.1	1.00e-175	29	413	21	404
QUT61445.1	2.01e-175	29	413	21	404
QQA29935.1	2.01e-175	29	413	21	404
BBK86564.1	8.10e-175	29	413	21	404
QPH57878.1	1.76e-172	26	407	17	397

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NFV_A	3.31e-108	31	381	6	355	Crystalstructure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.95 A resolution [Bacteroides ovatus ATCC 8483],3NNB_A Crystal structure of an alginate lyase (BACOVA_01668) from Bacteroides ovatus at 1.60 A resolution [Bacteroides ovatus ATCC 8483]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000435	0.989710	0.009159	0.000229	0.000224	0.000209

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004188_00190.