CAZyme Information: MGYG000004188_00039

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004188_00039
• CAZy Family: GH171
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
423		47561.96	8.1522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004188	3351981	MAG	United Kingdom	Europe

• Gene Location: Start: 50104; End: 51375 Strand: +

Full Sequence      

MNRKNILTSGTGLEKTLLFLFLCLSLSAQAQKIRIKTGIEVLKAQNFRCLEGKRVGLITN
PTGVDNELRSTIDILHEAPNVNLVVLYGPEHGVRGDVHAGDHVADQRDPATGLPVYSLYG
KTRKATPEMLKDVDVLVYDIQDIGCRSFTYISTLGLAMEAAAENGKELIVLDRPNPLGGL
KVEGNLTEDDCISFVSQFKIPYVYGLTCGELALLLNGERMLTGGVQCKLTVIKMKGWKRR
MDYTATGLQWIPSSPHIPHPHSAFFYPVSGILGELGYMSIGVGYTIPFQMFAASWAEADK
LADALNDLHVPGIIFRPIYLKPFYSVGKGEQLQGVQVHITDYARAPLSPLQFLVMQEVAR
LWPERAVFDHADKGRFAMFDKVCGSHQIRERFTKANRWEDIRPYWEKDVENFRRISTKYY
LYR

Enzyme Prediction     

No EC number prediction in MGYG000004188_00039.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH171	55	422	8.4e-127	0.9971830985915493

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07075	DUF1343	0.0	56	422	1	362	Protein of unknown function (DUF1343). This family consists of several hypothetical bacterial proteins of around 400 residues in length. The function of this family is unknown.
COG3876	YbbC	1.33e-146	30	422	21	409	Uncharacterized conserved protein YbbC, DUF1343 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRQ49036.1	4.47e-261	32	423	22	413
ADV42425.1	9.02e-261	32	423	22	413
QUT44744.1	2.28e-259	32	423	24	415
QPH58392.1	3.35e-256	32	423	22	413
QBJ18087.1	4.75e-256	32	423	22	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K05_A	3.75e-230	32	423	10	399	Crystalstructure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343],4K05_B Crystal structure of a DUF1343 family protein (BF0371) from Bacteroides fragilis NCTC 9343 at 1.65 A resolution [Bacteroides fragilis NCTC 9343]
4JJA_A	1.12e-48	32	423	3	369	Crystalstructure of a DUF1343 family protein (BF0379) from Bacteroides fragilis NCTC 9343 at 1.30 A resolution [Bacteroides fragilis NCTC 9343]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40407	3.77e-108	32	422	34	414	Uncharacterized protein YbbC OS=Bacillus subtilis (strain 168) OX=224308 GN=ybbC PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000391	0.998713	0.000386	0.000168	0.000156	0.000145

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004188_00039.