CAZyme Information: MGYG000004185_01760

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_01760
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
407	MGYG000004185_13|CGC2	46958.78	7.8108

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 36586; End: 37809 Strand: -

Full Sequence      

MRKNFVCKLFVAGVLMLLPCAMKAQRVSADQPWSVRMSESEMIRCPESWQLDFQPKLKWD
YCHGLELQAMLDVYDRYGDEKFYKYALAYADTMVNADGSIKKYKLEEYSLDRVNSGKFIF
RIYEQTKDVKYKKALDLMRSQFDGHPRNADGGFWHKKVYPNQVWLDGIYMGAPFYAEYAF
RNNQVEVYPDVVNQFLMAARHTYDPKNGLYRHACDVSRKERWADPVTGQSQHCWGRALGW
YAMAFVDALEFIPEHEAGRDSMLVILNNVATQIKRLQDAKTGLWYQVLDKSGEPGNYLES
SCSAMFVYSLFKGVRKGYIDKSYLQVAIKGYEGILKHFIEVDENGLVSITQACAVAGLGG
KNYRMGDYTYYINETIRANDAKAVGPFIMASLEYERLQEVKDIVCQK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	52	396	9e-121	0.9819277108433735

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.65e-129	33	398	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	2.27e-106	53	397	28	356	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT45768.1	4.25e-258	1	407	1	407
QRQ48639.1	4.25e-258	1	407	1	407
QDO69177.1	3.91e-256	1	407	1	406
QUT93209.1	1.12e-255	1	407	1	406
ALJ61262.1	1.12e-255	1	407	1	406

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	3.96e-112	59	397	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	2.04e-84	52	397	32	367	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	8.47e-84	52	397	22	357	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3QWT_A	4.13e-22	42	337	48	331	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3K11_A	1.80e-21	147	397	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.12e-83	52	397	32	367	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	1.52e-44	170	393	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	1.52e-44	170	393	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000415	0.390321	0.608581	0.000363	0.000184	0.000132

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004185_01760.