CAZyme Information: MGYG000004185_01626

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_01626
• CAZy Family: GH63
• CAZyme Description: Glucosidase YgjK

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
646	MGYG000004185_11|CGC3	73498.66	5.4485

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 85514; End: 87454 Strand: +

Full Sequence      

MNNIIKHILYTLLLLVGFTSCKSSDNSQTGLRYDYPNILDIAYTPDTLHRCYGWFTDAGS
WMGFTPAESEQWINGFCGPFSLDMFSRNWIAQSAALVGFANHDNGTFTPDSVCYFPGELY
ISAHSDKGSITQRLNFVSANTALLQVESQPAETLAIAGSQWDKDIRLTIEKNSVIAQHGN
GECVVLTFHPNANLKLTEGNYMATIQAEKHPVYVAISFFTSLQEAEGKIGSLTSLVQAPQ
KELLANAQRWDGYLNRILRKDMKPEYDRIAVKAVTTLISNWRTHRGGLLHEGIIPSHAVG
YFVGFWAWDSWRFSAGTSQFAPELAKNNIRAMFDYQLPDGMIIDCIYTDPAENNARDSKP
PLVCWAVDEIFKHTGDTAFVAEMYPQLLRYYKWWYAKRDHNHNGMCEYGSTDGTLEAAAW
ESGMDNAIRFDDAVMLSNQGHDDAWSMNQESVDLNAYLALECKLLKKFAQLLNTNFDGPD
YSNQVANYFFDEKANFFFDRRLEDGSFIEQPGCEAYTPLWTRIATQEQVDRMLPMLQDTA
KFSTYIPFPTIAADNPKYNPRGYWRGPIWLDQTYFAIRGLRNYGYHELADKYTLQVFDRL
KGLKNGAPIHENYGTHTGERLKAPHFSWSSSHLLMLYEDYGKTDMP

Enzyme Prediction     

No EC number prediction in MGYG000004185_01626.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	197	640	2.7e-110	0.5666666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	3.06e-128	11	643	5	786	alpha-glucosidase; Provisional
COG3408	GDB1	9.58e-20	322	637	302	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	2.10e-12	300	591	123	450	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam03200	Glyco_hydro_63	9.71e-07	377	638	185	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	3.39e-04	358	591	222	494	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ59646.1	0.0	7	642	7	642
QDO68010.1	0.0	7	642	7	642
QUT89313.1	0.0	7	642	7	642
BBK86099.1	0.0	8	642	8	642
QUT65331.1	0.0	8	642	8	642

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	4.47e-75	34	640	4	756	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.30e-74	34	640	4	756	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.19e-74	34	640	4	756	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3D3I_A	2.21e-71	34	640	5	757	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]
7PQQ_B	2.89e-38	34	489	330	838	ChainB, Anti-RON nanobody,Megabody 91,Glucosidase YgjK [Lama glama]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	1.89e-74	11	640	11	779	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
D8QTR2	1.01e-17	298	631	90	479	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
D8T3S4	2.39e-17	298	631	90	479	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
P94250	3.65e-09	329	602	92	347	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000258	0.167892	0.831623	0.000067	0.000089	0.000075

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004185_01626.