CAZyme Information: MGYG000004185_01476

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_01476
• CAZy Family: GH26
• CAZyme Description: Mannan endo-1,4-beta-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
371	MGYG000004185_9|CGC3	41430.86	5.6414

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 143338; End: 144453 Strand: +

Full Sequence      

MKNLKLLAWALLAGLTVSCNSTGKQASEETVKNTRTAETELLLKNLKKVSAQGIMFGHHD
DTVYGIGWEGDPGRSDVKSVCGDYPAVISFDLGELELGGEANLDKVAFDTLRKEIVNQYL
RGGMVSLSWHARNPKTGGDAWDVTDTTVVKSILPGGECHQKFAGWLGSVASFINSLQTAD
GVKVPVLFRPWHEHTGSWFWWGEKLCTPEDYKELWHMTVDTLRAKGVDNALFAYSPGSEP
RDTTEYLRRYPGDDLIDLIGFDTYQFNRDVYLEGLNRSLAIVDSIGKAHDKVIAVTETGY
EGIPDAKWWTGTLLPALEKYPVAYVLVWRNAREKVTHFYAPYPGQTSEADFVEFYKNPKT
LFAGDVKLYAK

Enzyme Prediction     

EC	3.2.1.-	3.2.1.100

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	32	358	2.8e-61	0.9702970297029703

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02156	Glyco_hydro_26	9.53e-34	36	264	6	230	Glycosyl hydrolase family 26.
COG4124	ManB2	2.13e-19	184	357	180	328	Beta-mannanase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT33719.1	5.22e-227	1	369	1	370
QUU00579.1	5.22e-227	1	369	1	370
QQA30566.1	5.22e-227	1	369	1	370
QUT62100.1	5.22e-227	1	369	1	370
BBK85879.1	5.62e-227	1	369	3	372

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZXO_A	1.97e-172	35	365	8	338	Thestructure of a GH26 beta-mannanase from Bacteroides ovatus, BoMan26A. [Bacteroides ovatus]
2VX4_A	1.26e-81	36	366	39	391	CellvibrioJaponicus Mannanase Cjman26c Native Form [Cellvibrio japonicus],2VX6_A CELLVIBRIO JAPONICUS MANNANASE CJMAN26C Gal1Man4-BOUND FORM [Cellvibrio japonicus]
2VX5_A	1.26e-81	36	366	39	391	CellvibrioJaponicus Mannanase Cjman26c Mannose-Bound Form [Cellvibrio japonicus]
4CD4_A	2.44e-81	36	366	62	414	Thestructure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManIFG [Cellvibrio japonicus Ueda107],4CD5_A The structure of GH26 beta-mannanase CjMan26C from Cellvibrio japonicus in complex with ManMIm [Cellvibrio japonicus Ueda107]
2VX7_A	1.00e-80	36	366	39	391	CellvibrioJaponicus Mannanase Cjman26c Mannobiose-Bound Form [Cellvibrio japonicus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P49424	2.94e-53	24	367	43	412	Mannan endo-1,4-beta-mannosidase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=manA PE=1 SV=2
A1A278	1.78e-44	36	363	48	395	Mannan endo-1,4-beta-mannosidase OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) OX=367928 GN=BAD_1030 PE=1 SV=1
O05512	4.86e-18	77	330	79	326	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuG PE=1 SV=2
P55278	5.46e-17	56	328	61	322	Mannan endo-1,4-beta-mannosidase OS=Bacillus subtilis OX=1423 PE=3 SV=1
P49425	2.28e-16	77	310	189	424	Mannan endo-1,4-beta-mannosidase OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) OX=518766 GN=manA PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000059	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004185_01476.