CAZyme Information: MGYG000004185_00925

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_00925
• CAZy Family: GH25
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		33775.52	8.4143

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 131363; End: 132232 Strand: +

Full Sequence      

MPVKTKETVRGKNTTTRKRPSATRQRGKKNTKPTSHVMPLWVRNTLAVCIVLVFFAGFYW
FFIRPYSYRWKPCYGMKGYGVCMPCNYDIHGIDISHYQGNIDWEKLTHSADLRFPLHFIF
IKATEGGDHGDDTFLDNFEKAREHGFIRGAYHYFLPQTDARKQADFFIRTVPLTTGDLPP
VLDVETTGKKDEAELKKGVLTWLNQVEAHYGVKPILYTSYKFKMRYLNDSIFNTYPYWIA
HYYVDSVRYQGKWHFWQHTDVGTVPGIEEEVDLDVFNGTLEELQDLTLP

Enzyme Prediction     

No EC number prediction in MGYG000004185_00925.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH25	92	267	1.4e-54	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06524	GH25_YegX-like	3.93e-89	90	278	1	194	YegX is an uncharacterized bacterial protein with a glycosyl hydrolase family 25 (GH25) catalytic domain that is similar in sequence to the CH-type (Chalaropsis-type) lysozymes of the GH25 family of endolysins.
cd06413	GH25_muramidase_1	2.22e-69	87	278	1	191	Uncharacterized bacterial muramidase containing a glycosyl hydrolase family 25 (GH25) catalytic domain. Endo-N-acetylmuramidases are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues.
pfam01183	Glyco_hydro_25	2.51e-62	92	267	1	180	Glycosyl hydrolases family 25.
cd00599	GH25_muramidase	2.97e-61	90	276	1	186	Endo-N-acetylmuramidases (muramidases) are lysozymes (also referred to as peptidoglycan hydrolases) that degrade bacterial cell walls by catalyzing the hydrolysis of 1,4-beta-linkages between N-acetylmuramic acid and N-acetyl-D-glucosamine residues. This family of muramidases contains a glycosyl hydrolase family 25 (GH25) catalytic domain and is found in bacteria, fungi, slime molds, round worms, protozoans and bacteriophages. The bacteriophage members are referred to as endolysins which are involved in lysing the host cell at the end of the replication cycle to allow release of mature phage particles. Endolysins are typically modular enzymes consisting of a catalytically active domain that hydrolyzes the peptidoglycan cell wall and a cell wall-binding domain that anchors the protein to the cell wall. Endolysins generally have narrow substrate specificities with either intra-species or intra-genus bacteriolytic activity.
COG3757	Acm	6.17e-54	84	284	58	261	Lyzozyme M1 (1,4-beta-N-acetylmuramidase), GH25 family [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ADV44824.1	8.96e-170	18	288	16	286
QQA28851.1	3.38e-166	1	288	1	283
QUT98387.1	3.38e-166	1	288	1	283
QMI80999.1	1.37e-165	1	288	1	283
QPH56524.1	1.37e-165	1	288	1	283

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2WAG_A	4.69e-31	87	284	14	214	TheStructure of a family 25 Glycosyl hydrolase from Bacillus anthracis. [Bacillus anthracis str. Ames]
1JFX_A	3.00e-25	89	283	5	209	Crystalstructure of the bacterial lysozyme from Streptomyces coelicolor at 1.65 A resolution [Streptomyces coelicolor]
4KRU_A	2.07e-24	88	276	19	207	X-raystructure of catalytic domain of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
4KRT_A	1.75e-23	88	276	19	207	X-raystructure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101],4KRT_B X-ray structure of endolysin from clostridium perfringens phage phiSM101 [Clostridium phage phiSM101]
6ZMV_A	2.42e-16	89	286	2	203	ChainA, muramidase [Trichobolus zukalii],6ZMV_B Chain B, muramidase [Trichobolus zukalii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8FFY2	6.39e-60	62	284	45	262	Uncharacterized protein YegX OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=yegX PE=3 SV=2
P76421	9.03e-60	62	284	45	262	Uncharacterized protein YegX OS=Escherichia coli (strain K12) OX=83333 GN=yegX PE=3 SV=2
Q8X7H0	1.02e-58	62	284	45	262	Uncharacterized protein YegX OS=Escherichia coli O157:H7 OX=83334 GN=yegX PE=3 SV=2
P25310	7.78e-24	89	283	82	286	Lysozyme M1 OS=Streptomyces globisporus OX=1908 GN=acm PE=1 SV=1
P26836	3.15e-23	88	286	8	203	Probable autolytic lysozyme OS=Clostridium perfringens (strain 13 / Type A) OX=195102 GN=lyc PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999938	0.000054	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
40	62