CAZyme Information: MGYG000004185_00621

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_00621
• CAZy Family: GH33
• CAZyme Description: Sialidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
381		42592.79	6.4127

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 160937; End: 162082 Strand: -

Full Sequence      

MKKKLALAFMASAVVLLAPAQNTGSKPQNPGVNSLPGQTLFEKSMKEGVSCYRIPSIVTA
ANGDLVAAIDERVLSCGDLKWNRDINIVVRRSHDNGKTWTGIETVVDFPLGQSASDPSMV
VDKETGEIFLFYNYMDLDKEKDVYYFHVVSSRDNGKTWSQPRDITSSLSTDDMKPDFKFI
TSGRGTCTSDGKLLHTIVNLKKGLYVFGSDDHGKTWYFIDHPLTPGDESKIIELPDGRWM
VSSRVNKAGLRYAHVSDDQGHTWTTRPDSALTDPGCNGSILAYSSHRQGDDRDRVILSHL
ADPKDRRNLVVRLSYDNGQTWPYCKTICAGSAAYSSLTVLDNGDIAIFYEKDDYQKNEFA
VFTLDWLTDGQDTFRKPTRRD

Enzyme Prediction     

No EC number prediction in MGYG000004185_00621.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH33	41	358	1.2e-82	0.9473684210526315

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd15482	Sialidase_non-viral	1.75e-94	38	363	1	339	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
pfam13088	BNR_2	9.29e-21	82	347	15	280	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.
COG4409	NanH	1.80e-16	48	357	271	647	Neuraminidase (sialidase) [Carbohydrate transport and metabolism, Cell wall/membrane/envelope biogenesis].
pfam15902	Sortilin-Vps10	0.001	89	216	3	109	Sortilin, neurotensin receptor 3,. Sortilin, also known in mammals as neurotensin receptor-3, is the archetypical member of a Vps10-domain (Vps10-D) that binds neurotrophic factors and neuropeptides. This domain constitutes the entire luminal part of Sortilin and is activated in the trans-Golgi network by enzymatic propeptide cleavage. The structure of the domain has been determined as a ten-bladed propeller, with up to 9 BNR or beta-hairpin turns in it. The mature receptor binds various ligands, including its own propeptide (Sort-pro), neurotensin, the pro-forms of nerve growth factor-beta (NGF)6 and brain-derived neurotrophic factor (BDNF)7, lipoprotein lipase (LpL), apo lipoprotein AV14 and the receptor-associated protein (RAP)1.
pfam13088	BNR_2	0.004	63	238	114	277	BNR repeat-like domain. This family of proteins contains BNR-like repeats suggesting these proteins may act as sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHT70737.1	2.15e-164	38	380	33	375
QFZ55957.1	8.11e-164	40	381	32	373
AWV97239.1	1.94e-163	1	374	1	364
ASO05493.1	2.43e-161	38	380	32	374
APQ16737.1	3.57e-161	38	381	34	377

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1EUR_A	9.24e-42	46	367	19	359	Sialidase[Micromonospora viridifaciens],1EUS_A Sialidase Complexed With 2-Deoxy-2,3-Dehydro-N- Acetylneuraminic Acid [Micromonospora viridifaciens]
1W8N_A	3.88e-41	46	367	15	355	Contributionof the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens. [Micromonospora viridifaciens],1W8O_A Contribution of the Active Site Aspartic Acid to Catalysis in the Bacterial Neuraminidase from Micromonospora viridifaciens [Micromonospora viridifaciens]
1EUT_A	3.76e-40	46	367	19	359	Sialidase,Large 68kd Form, Complexed With Galactose [Micromonospora viridifaciens],1EUU_A Sialidase Or Neuraminidase, Large 68kd Form [Micromonospora viridifaciens]
1WCQ_A	1.29e-39	46	367	15	355	Mutagenesisof the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_B Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens],1WCQ_C Mutagenesis of the Nucleophilic Tyrosine in a Bacterial Sialidase to Phenylalanine. [Micromonospora viridifaciens]
2BZD_A	2.45e-39	46	367	15	355	Galactoserecognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_B Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens],2BZD_C Galactose recognition by the carbohydrate-binding module of a bacterial sialidase. [Micromonospora viridifaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q02834	1.06e-42	5	367	20	401	Sialidase OS=Micromonospora viridifaciens OX=1881 GN=nedA PE=1 SV=1
P31206	1.03e-28	50	350	201	526	Sialidase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=nanH PE=3 SV=2
O35657	3.88e-23	49	351	68	389	Sialidase-1 OS=Mus musculus OX=10090 GN=Neu1 PE=1 SV=1
Q99PW3	7.22e-23	49	351	68	389	Sialidase-1 OS=Rattus norvegicus OX=10116 GN=Neu1 PE=1 SV=1
P29767	2.20e-21	48	367	391	826	Sialidase OS=Clostridium septicum OX=1504 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000368	0.998424	0.000626	0.000204	0.000194	0.000163

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004185_00621.