CAZyme Information: MGYG000004185_00268

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_00268
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
360	MGYG000004185_1|CGC9	42127.53	8.8584

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 368127; End: 369209 Strand: -

Full Sequence      

MKRVLILILALWGFLFTAAAKDNKEEDRKLIDKVAMWQIDHYAKVKHHDLAWTNGVLFRG
MVEWAYYTDDARYYDFLRKIGEKHDWKFLKRLYHADDLVVAQMYIRMFEKYKEEAMIRPT
IARVDSVVANPSTARLWLGAKRWSERWSWCDALFMAPPVYGLLNRLYPEKHYLDFMDREF
KEATDSLYDEEAHLYYRDRRYIPKRERNGEKVFWGRGNGWVFAGLPLLLETLPKDHVTYQ
YYLSIYKEMADAVVRCQDKQGSWHASLLDPSSYPAPENSASGFFTYGLAWGVNHGILKGK
KYKKAALQGWKALKSYVHEDGMLGYVQPVSAAPEQVTKDMTEVYGVGAFLLAGIEMLEMK

Enzyme Prediction     

No EC number prediction in MGYG000004185_00268.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	46	357	4.1e-87	0.9698795180722891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	2.16e-112	31	360	2	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.89e-53	52	358	36	355	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AAO78027.1	4.95e-231	1	360	1	360
QMW85349.1	4.95e-231	1	360	1	360
QQA08868.1	2.86e-230	1	360	1	360
ASM64975.1	1.16e-229	1	360	1	360
QUU06691.1	1.16e-229	1	360	1	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	6.51e-81	23	360	25	370	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.25e-56	30	355	36	370	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	2.29e-44	21	355	7	353	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
3QWT_A	4.52e-14	149	323	167	338	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
3PMM_A	2.67e-13	149	323	168	339	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
L7P9J4	3.10e-80	2	360	3	377	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	2.47e-79	28	357	58	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
T2KPL9	2.41e-73	15	360	23	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000376	0.998715	0.000367	0.000176	0.000168	0.000162

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004185_00268.