CAZyme Information: MGYG000004185_00087

Basic Information

• Species: Bacteroides sp900553815
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp900553815
• CAZyme ID: MGYG000004185_00087
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
342		37304.6	9.9355

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004185	3289740	MAG	United Kingdom	Europe

• Gene Location: Start: 117957; End: 118985 Strand: -

Full Sequence      

MKLLVIRLSAFGDVAMTVPVIDSLARQYPQLDITVLSRPFMAPLFSLMPANVHFRGIDLA
QNDGPSGLLALFRQLRGEGFNLVADLHDVLRSKVLRTLFFLSGVKTAHIDKGRRGKKALV
RQHGKELVEQPTSFSRYAAVFARLGYPVEPAFHSIYGQGKGDASLFASVAVPACGERWIG
VAPFAAHRGKILPQATVEELLRRLTADNRHRVFLFGGGGQERAAMEQWAAAYPRVVSLSG
KLKLDGELALISHLNVMVSMDSANMHLASLVGVPVVSVWGATHPFAGFMGWGQSMDNTVQ
LDLPCRPCSIFGNKPCLRGDYACLEGLKAEMIMNKINLILGV

Enzyme Prediction     

No EC number prediction in MGYG000004185_00087.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	70	316	3.5e-37	0.9466666666666667

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	2.46e-54	2	337	1	276	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.19e-42	1	340	2	330	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	1.30e-16	69	308	2	236	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	2.87e-12	2	301	7	306	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	7.95e-06	1	284	1	292	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM58063.1	4.83e-159	1	336	1	336
AVM53138.1	1.33e-154	1	336	1	336
QNT67212.1	1.92e-127	3	341	6	359
QUT74155.1	2.25e-127	2	336	3	339
QUT89241.1	1.20e-126	2	336	3	338

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9R9D5	2.86e-09	12	300	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1
Q57336	7.06e-09	2	284	10	286	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P25742	9.53e-08	12	300	5	293	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004185_00087.