CAZyme Information: MGYG000004182_01542

Basic Information

• Species: Phocaeicola sp900551445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551445
• CAZyme ID: MGYG000004182_01542
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
642	MGYG000004182_32|CGC1	72475.48	5.7332

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004182	3344512	MAG	United Kingdom	Europe

• Gene Location: Start: 29275; End: 31203 Strand: -

Full Sequence      

MVQANANLVRWMHVTPWKQDVESCDRVGLIQAMPAGDAEKDCQGRQWEQRKLVMRDAIIY
NRNNPSILFYECGNESISREHMQEMKEIRDRFDYHGGRAVGSREMLDIREAEYGGEMLYI
NKSAHHPMWAMEYCRDEGLRKYWDNYSYPYHQDGEGNVAYHSAATGKTQKQADASVYNRN
QDSFTIENVIRWFDYWRERPGTGKRVSSGGAKIIFSDTNTHFRGVENYRRSGDTDPMRIP
KDSYFAHQVMWDGWVDTENPRLHIVGHWNYEDGVVKPVYVVSNTDSVALFLNGKSMGKAR
REYHFLFTFDQVAFVPGVLEAVGYNEGKEVVRSQLKTAGEPVALKLSAMQHPKGWRADGA
DVVLLQVEVVDAAGARCPLANHLVHFSVEGPAEWRGGIAQGPDNYILSENLPVECGVNRV
LLRSTTTAGKVRVKAEAEGLQPVSLELVSSPVEVQGGLSTYIPGNELEGILSRGETPLSP
SYVTRAVDVPVLSAEAGCNASEAVKSFDDNELSEWRNDGRPSTAWIKYHLERMARVDEIC
MKLTGWRMRSYPLEIYAGDELIWSGETEKSLGYVHLKVKPVPASEITIRLKGSSKEDDAF
GQIVEVTAPVANELDLFKAKDGDKTNHELRIVEIEFKENLHQ

Enzyme Prediction     

EC	3.2.1.31

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam18565	Glyco_hydro2_C5	1.18e-21	344	446	1	103	Glycoside hydrolase family 2 C-terminal domain 5. Domain 5 is found in dimeric beta-D-galactosidase from Paracoccus sp. 32d, which contributes to stabilization of the functional dimer. It is suggested that the location of this domain 5, may be one of the factors responsible for the creation of a functional dimer and cold-adaptation of this enzyme.
pfam16355	DUF4982	3.41e-18	273	332	1	61	Domain of unknown function (DUF4982). This family is found in the C-terminal of uncharacterized proteins and beta-galactosidases around 680 residues in length from various Bacteroides species. The function of this protein is unknown.
COG3250	LacZ	5.12e-07	1	390	330	741	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam02369	Big_1	9.58e-05	357	435	1	64	Bacterial Ig-like domain (group 1). This family consists of bacterial domains with an Ig-like fold. Members of this family are found in bacterial surface proteins such as intimins and invasins involved in pathogenicity.
smart00634	BID_1	1.68e-04	357	444	14	89	Bacterial Ig-like domain (group 1).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VTZ55473.1	0.0	1	642	345	986
VTZ55419.1	0.0	1	642	345	986
VDS02705.1	0.0	1	642	262	903
VTZ55176.1	0.0	1	642	234	875
VDS02461.1	0.0	1	642	345	986

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6HPD_A	1.78e-84	1	463	373	818	Thestructure of a beta-glucuronidase from glycoside hydrolase family 2 [Formosa agariphila KMM 3901]
5T98_A	9.28e-28	1	441	337	812	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]
4CUC_A	1.11e-24	1	396	336	784	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA. [Streptococcus pneumoniae TIGR4]
4CU6_A	1.48e-24	1	396	336	784	Unravellingthe multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU7_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4],4CU8_A Unravelling the multiple functions of the architecturally intricate Streptococcus pneumoniae beta-galactosidase, BgaA [Streptococcus pneumoniae TIGR4]
7CWD_A	2.48e-24	1	440	324	792	ChainA, beta-glalactosidase [Niallia circulans],7CWI_A Chain A, beta-galactosidase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KN75	8.64e-84	1	463	364	809	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	6.12e-24	3	447	359	846	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	1.36e-20	7	390	358	758	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
P77989	2.03e-11	7	437	319	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KPJ7	5.29e-09	6	337	360	706	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999998	0.000057	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004182_01542.