CAZyme Information: MGYG000004182_01235

Basic Information

• Species: Phocaeicola sp900551445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp900551445
• CAZyme ID: MGYG000004182_01235
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
947	MGYG000004182_22|CGC1	105742.66	5.6194

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004182	3344512	MAG	United Kingdom	Europe

• Gene Location: Start: 17350; End: 20193 Strand: +

Full Sequence      

MKKRLFYYLLSCTSLCAVTAQALEVSKTYVPKKKSMYHKEWIDFNKNGRKDIYEDPKAPL
NDRIEDLLSQMTMEEKTCQMVTLYGYQRVLKDSLPTPEWKNELWKDGIGAIDEHLNSFRG
WGVPPLKNDLVWPASHHAWALNEVQRFFIEETRLGIPVDFTNEGIRGVENYIATNFPTQL
ALGHTWDRELIHQVGYITGREARLLGYTNVYAPILDVGRDQRWGRYEEVYGESPYLVAEL
GIAMGKGLQTDMQVASTAKHFVAYSNNKGAREGFARVDPQMSPREVENIHVYPFTRVIQE
AGILGVMSSYNDYDGFPIQSSYYWLTQRLRGTMGFRGYVVSDSDAVEYLYSKHKTAKDMK
EAVRQSVEAGLNVRCTFRSPESYVLPLRELIQEGGLSMETINNRVRDILRVKFLTGLFDA
PYQTDLALADKEVHSEAHQQVALQASREGLVLLKNEKGLLPLDKSQIRRIAVCGPNADEK
SFALTHYGPVAVEVTTVLEGIKQQVKEGTEVTYTKGCDLVDANWPESEIIHYPLTAAEKE
GIQQAVDNVKESDVAVVVLGGGIRTCGENKSRTSLELPGRQQQLLEAIVATGKPVVLVLI
NGRPLSINWADKFAPSILEAWYPGSQGGTAIAEALFGAYNPGGKLTVTFPKTVGQIPFNF
PAKPASQVDGGQTPGMEGNQSRINGPLYPFGYGLSYTTFEYADLKLSSPVITDKEPVTVT
CKVTNTGSRSGDEVVQLYTRDVISSVTTYEKNLRGFERVHLEPGETKEVSFQLLPRDFQL
LNKDNHWVVEPGMFQIMIGASSEDIRLKKGLEIRAYGQASANETIESDPRDFISASKNKS
HIIHVVDGDYSTTWKGDKGEYISFELAENAKVDHIDVAWKNAEAGSRYEIQISSGGGQFL
PVQSGEVKPNQEESIQFNKTGGSDLRILITNGSAEIAEIKLPELRKE

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	150	375	3.4e-62	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.80e-171	51	806	22	758	beta-glucosidase BglX.
PLN03080	PLN03080	2.21e-95	122	799	80	769	Probable beta-xylosidase; Provisional
COG1472	BglX	1.30e-75	137	510	41	392	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.59e-69	450	696	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	2.30e-59	72	411	1	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VDS02681.1	0.0	36	947	1	912
QUT50560.1	0.0	12	945	20	954
QQT77476.1	0.0	1	946	1	946
QRP57280.1	0.0	1	946	1	946
ASM65968.1	0.0	1	946	1	946

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	1.37e-133	141	806	69	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	7.42e-133	141	806	69	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	7.35e-123	141	806	68	744	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5Z87_A	5.13e-121	137	806	104	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	2.29e-120	53	806	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	9.15e-144	153	808	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	1.16e-127	64	810	38	760	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	2.02e-123	64	810	38	760	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	1.78e-113	53	806	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	4.21e-88	64	805	39	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003794	0.840161	0.154352	0.000867	0.000429	0.000365

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004182_01235.