CAZyme Information: MGYG000004181_00542

Basic Information

• Species: Collinsella sp002232035
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp002232035
• CAZyme ID: MGYG000004181_00542
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase BglB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479	MGYG000004181_8|CGC1	55257.88	4.5454

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004181	2117365	MAG	United Kingdom	Europe

• Gene Location: Start: 8654; End: 10093 Strand: +

Full Sequence      

MHKVPRTFPEGFLWGGAVAANQCEGAWDVDGKAPSVADINEFRDDIPIGEKHNREITTTF
IKEALESEDRIFPKREGIDFYHTYPEDLELLADMGLNTFRTSIAWSRIFPNGDDAEPNEE
GLAFYDRLFDKMIELGMEPMVTLSHYEMPINLTLSYTGWYSRETIDCFERYCKVVFDRYA
GKVKYWILVNQINLIEHESFNHLGVAEDKVDDLPSAKYQAVMNEMVACGRATRYAHEHHP
EMQIGMMLCGGPSYAASCKPEDALATLRFNQMQFFFSDVLLRGEVPGSAYRFWEDNGIKV
QISDQDIEDLRNTADFCTFSYYYVRVVSKESFEDGYDAKRNKELPANPWGWCIDPLGLRF
TLNAYWDRYRKPIYITENGVGCYDTLEEDGTVHDPYRVDFYRAHLEQVREAIADGVDVRG
YYAWGPIDIVSCSSSEMSKRYGFIYVDRDDYGHGTGKRVLKDSYYWAKHVIETNGADLD

Enzyme Prediction     

EC	3.2.1.86	3.2.1.21	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	475	1.4e-138	0.9906759906759907

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	0.0	5	479	1	458	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
PRK09852	PRK09852	6.52e-180	7	479	3	474	cryptic 6-phospho-beta-glucosidase; Provisional
PRK09589	celA	6.17e-171	7	478	3	476	6-phospho-beta-glucosidase; Reviewed
PRK09593	arb	4.47e-169	6	479	4	478	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	2.20e-144	7	478	5	477	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SEU01988.1	3.18e-266	1	478	1	477
ADL02654.1	6.75e-261	1	478	1	477
QRV19127.1	6.75e-261	1	478	1	477
QIX07655.1	4.34e-260	1	479	1	481
ASU19718.1	1.76e-259	1	479	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6WGD_A	3.78e-163	1	478	1	469	Crystalstructure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_B Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis],6WGD_C Crystal structure of a 6-phospho-beta-glucosidase from Bacillus licheniformis [Bacillus licheniformis]
4F66_A	3.69e-140	9	478	8	480	Thecrystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans],4F66_B The crystal structure of 6-phospho-beta-glucosidase from Streptococcus mutans UA159 in complex with beta-D-glucose-6-phosphate. [Streptococcus mutans]
4F79_A	1.05e-139	9	478	8	480	Thecrystal structure of 6-phospho-beta-glucosidase mutant (E375Q) in complex with Salicin 6-phosphate [Streptococcus mutans],4GPN_A The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159],4GPN_B The crystal structure of 6-P-beta-D-Glucosidase (E375Q mutant) from Streptococcus mutans UA150 in complex with Gentiobiose 6-phosphate. [Streptococcus mutans UA159]
4IPL_A	6.01e-138	8	478	20	485	Thecrystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPL_B The crystal structure of 6-phospho-beta-glucosidase BglA-2 from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_B The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4],4IPN_E The complex structure of 6-phospho-beta-glucosidase BglA-2 with thiocellobiose-6P from Streptococcus pneumoniae [Streptococcus pneumoniae TIGR4]
2XHY_A	1.86e-137	7	478	7	479	CrystalStructure of E.coli BglA [Escherichia coli K-12],2XHY_B Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_C Crystal Structure of E.coli BglA [Escherichia coli K-12],2XHY_D Crystal Structure of E.coli BglA [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P11988	4.25e-157	6	478	2	462	6-phospho-beta-glucosidase BglB OS=Escherichia coli (strain K12) OX=83333 GN=bglB PE=1 SV=2
Q48409	2.60e-154	6	478	2	462	Phospho-cellobiase OS=Klebsiella oxytoca OX=571 GN=casB PE=3 SV=1
P26206	8.77e-153	8	478	5	463	6-phospho-beta-glucosidase OS=Dickeya chrysanthemi OX=556 GN=arbB PE=3 SV=1
P40740	2.01e-152	1	478	1	469	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2
P24240	2.88e-148	7	479	3	474	6-phospho-beta-glucosidase AscB OS=Escherichia coli (strain K12) OX=83333 GN=ascB PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000032	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004181_00542.