CAZyme Information: MGYG000004174_00760

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-74; Firm-11
• CAZyme ID: MGYG000004174_00760
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
769	MGYG000004174_17|CGC1	85181.86	5.7317

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004174	2366989	MAG	United Kingdom	Europe

• Gene Location: Start: 15811; End: 18120 Strand: +

Full Sequence      

MSEKTNLNLNWRFHLGDEPGADFMGHDDAAWREISLPHDWSVEHPFDRSYASGTGYLPGG
VAWYRKRFTLPDDLTGKRVRLTFGGVYNHARVWVNSNYLGERAFGYATFTHDVTAFVRPG
ENVIAVRVAHEQVADSRWFTGSGIYRDVTLEVSDLCCFETDGVFVTTEAVDANGTARLRV
AYETLNATGARFILSNARGDAVASGSAWGKTGAAELLVPRAMLWSPEEPTLYTLTAQALQ
GERIADQLRLNVGIRTIRFDADKGFFLNGVNMKLKGVCVHHDAGCLGAAVPKTVWERRLR
KLKAAGCNALRTAHNPPDSHLLDLCDELGFLVMDEAFDEWEGAKNKWWQGHNVYPPKRYG
YAMDFPQWHRADLEGMVRRDRNHPCIVLWSIGNEIDYPNDPYVTPLFREVLGNNDANKPA
AERVYDPRKPDAGRLAVIARELTGIVHALDTTRPVTSALSFPELSNRTGYADALDAAGYN
YKEMFYAEDHARYPGRVIYGSENSKDPEAWYAVRDNDYICGQFLWTGVDFLGECPGWPKR
ISQAGMLDLAGFEKPQYAQRRALWTEQPYVRIAAGFADTDPADLNHEHFRWAGPSGRMMR
VSCYTNAEQVELFFNGASLGVRRLTPMDGCRACWELPYAPGELRAVIPGGEDKLGSCAEA
VSIALSPDATQLPADGQAVAQVEVSLLDVMGRAAEDERVTYQLVGDATILGVENGAPDDL
TPYAAPYRATLYGKAIVYVRAGLTPGDIVLHARTAGGLSAKCVLRQDSK

Enzyme Prediction     

No EC number prediction in MGYG000004174_00760.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	2	544	2.2e-120	0.5824468085106383

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	4.19e-79	1	533	9	505	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	2.01e-50	6	397	43	452	cryptic beta-D-galactosidase subunit alpha; Reviewed
PRK10150	PRK10150	8.73e-42	3	456	11	446	beta-D-glucuronidase; Provisional
PRK09525	lacZ	1.25e-31	2	394	50	462	beta-galactosidase.
pfam02837	Glyco_hydro_2_N	4.99e-31	7	150	4	165	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66250.1	0.0	1	761	1	757
QTE67710.1	0.0	1	761	1	756
QTE70152.1	0.0	1	761	1	757
QTE74124.1	0.0	1	761	1	757
QUI21602.1	1.15e-273	1	748	1	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T9A_A	1.21e-161	1	760	26	838	Crystalstructure of BuGH2Cwt [Bacteroides uniformis],5T9A_B Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_C Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9A_D Crystal structure of BuGH2Cwt [Bacteroides uniformis],5T9G_A Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_B Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_C Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis],5T9G_D Crystal structure of BuGH2Cwt in complex with Galactoisofagomine [Bacteroides uniformis]
6B6L_A	4.50e-148	11	753	14	764	Thecrystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838],6B6L_B The crystal structure of glycosyl hydrolase family 2 (GH2) member from Bacteroides cellulosilyticus DSM 14838 [Bacteroides cellulosilyticus DSM 14838]
7RSK_A	1.92e-147	11	753	14	764	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7RSK_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
3GM8_A	1.14e-123	3	740	5	772	ChainA, Glycoside hydrolase family 2, candidate beta-glycosidase [Phocaeicola vulgatus ATCC 8482]
5T98_A	2.33e-120	1	764	24	818	Crystalstructure of BuGH2Awt [Bacteroides uniformis],5T98_B Crystal structure of BuGH2Awt [Bacteroides uniformis],5T99_A Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis],5T99_B Crystal structure of BuGH2Awt in complex with Galactoisofagomine [Bacteroides uniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS9	1.65e-144	3	756	43	838	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
T2KM09	9.01e-103	4	741	48	795	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
T2KPJ7	6.72e-50	4	649	53	704	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P77989	1.67e-41	6	754	7	725	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
A5F5U6	5.29e-36	4	394	47	459	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999975	0.000031	0.000007	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004174_00760.