CAZyme Information: MGYG000004172_00232

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae
• CAZyme ID: MGYG000004172_00232
• CAZy Family: GH50
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
441	MGYG000004172_1|CGC10	50165.2	7.9614

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004172	3050906	MAG	United Kingdom	Europe

• Gene Location: Start: 309340; End: 310665 Strand: -

Full Sequence      

MVGYSGSVPVTNWTQAKTRILPYLVDFMADTTAATYKSRTNRYGSCIDKPRQEVTGRFYV
KKIDGRWWIVDPEGYLHYERSVTSLRKGSSDRNKSSWNSRFGSDSRWMQITQSELASIGF
HGTGAFCTDTYQVIQEYNRSNPDRPMTLAPSFGFLTNFRRAMNYEYPGGSSANAVGLVYY
GGWESFCETYIRTNLAVYLNDRNVLGFFSDNEIDFSSGGSKILSRFLSISDKTDKAYLAA
KQFMEEKGASSVTDALNSEFAGRVAEVYYKGVKEAIKKIDPGMMYLGTRLHGTPKYLQGV
VEAAGRYCDIVSINYYSRWSPELDTYVSKWATWANAPFMVTEFYTKAMDSDLPNTSGAGL
AVPTVKDKAYAYQHFTLGLLEAKNCVGWHWFKYQDDDGTDNDGKPANKGVYDNYYQMYPY
LAKYMKNLNYNVYSLIDYFDN

Enzyme Prediction     

No EC number prediction in MGYG000004172_00232.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH50	96	433	8.4e-51	0.5497702909647779

CDD Domains     

MGYG000004172_00232 has no CDD domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO68502.1	6.31e-235	2	440	73	515
QDH57425.1	1.62e-230	2	440	75	515
QUT44995.1	4.11e-217	2	441	74	518
QRQ49249.1	4.11e-217	2	441	74	518
QUT25415.1	3.75e-215	2	440	74	516

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5T3B_A	2.52e-133	9	440	51	480	ChainA, Glycoside Hydrolase [Phocaeicola plebeius],5T3B_B Chain B, Glycoside Hydrolase [Phocaeicola plebeius]
4BQ2_A	7.29e-14	41	434	245	744	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ2_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_C Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ3_D Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
4BQ4_A	1.70e-13	41	434	245	744	Structuralanalysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ4_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_A Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40],4BQ5_B Structural analysis of an exo-beta-agarase [Saccharophagus degradans 2-40]
6XJ9_A	4.55e-10	24	409	245	735	Structureof PfGH50B [Pseudoalteromonas fuliginea],6XJ9_B Structure of PfGH50B [Pseudoalteromonas fuliginea]
5Z6P_A	1.12e-06	265	409	595	735	Thecrystal structure of an agarase, AgWH50C [Agarivorans gilvus],5Z6P_B The crystal structure of an agarase, AgWH50C [Agarivorans gilvus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48840	2.18e-10	43	435	476	951	Beta-agarase B OS=Vibrio sp. (strain JT0107) OX=47913 GN=agaB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999818	0.000186	0.000026	0.000001	0.000001	0.000017

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004172_00232.