CAZyme Information: MGYG000004160_01829

Basic Information

• Species: QALW01 sp900552055
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; QALW01; QALW01 sp900552055
• CAZyme ID: MGYG000004160_01829
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
477		55090.87	4.5688

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004160	2175827	MAG	United Kingdom	Europe

• Gene Location: Start: 779; End: 2212 Strand: -

Full Sequence      

MPYESKNYRLWVHQTWPLVSRGEEKNYDRAMFTKGMLACGLAGFDEVYDMLRKFYDWFNS
AEEYLPYMLMDSMAIQGSVAGPMVYNSPAGVPEDIITTMKYYDLEWWMDFLKQRIPECIY
RFTLNRPHNYLITSIVAFFEEYKATGEQKYLDACKGGWDIYHNYFQNIGGGISICEHFEV
APNSQLIANLPTNIYETCANVFWIDLNHRLLQLEPDNELYAFHVEQSLYNIVLACQGEDG
RIRYFNHMNGVKYAPGRYNTCCEIQATAAIGMIPQFIYMPDEEGVYVNLFAASSMDVSVD
GKTFEINMDTRFPYEDTVYMTVKAPEKGRMKLRVRMPRWMTQTTDIYFDGEKVQTGEPGG
YAVFDREWEGSTVISFKLPMAMKATQYKGANTVEGKKRYALEYGPLLMAVRGPLTSEGIG
DNEPTLVLPLSIDELLGRLVRKGEKLEFAVKGLDEYDVIPYFDLEQEEFSCFPVFEK

Enzyme Prediction     

No EC number prediction in MGYG000004160_01829.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	122	409	8e-46	0.5646123260437376

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.20e-35	142	409	239	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.04e-33	130	434	232	521	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH16333.1	3.80e-182	1	473	444	916
QGA23996.1	1.59e-98	23	476	338	805
AXC12824.1	4.82e-94	19	473	371	817
QIA06584.1	1.56e-27	124	472	259	630
AWB45599.1	1.53e-26	87	472	206	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	5.54e-20	146	429	284	576	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6YQH_AAA	8.83e-20	153	472	295	647	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
4QK0_A	1.29e-18	146	429	284	576	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
5OPJ_A	1.98e-17	153	472	295	647	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	5.11e-16	145	413	265	549	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004160_01829.