CAZyme Information: MGYG000004160_00434

Basic Information

• Species: QALW01 sp900552055
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; QALW01; QALW01 sp900552055
• CAZyme ID: MGYG000004160_00434
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase C

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
193	MGYG000004160_15|CGC1	22374.66	5.1105

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004160	2175827	MAG	United Kingdom	Europe

• Gene Location: Start: 19787; End: 20368 Strand: -

Full Sequence      

MKREGKKKGKKVFWISFSLLAVLIIAAVLLRPMVLKWSYPLKYEEQVEKYAAEYGLDDML
VYSIIRCESSFDPEARSRAGACGLMQLMPTTAQWFAENKEKIEYSQEMLFDPDYNIRLGC
AYLSYLDERFDGNLGNMLAAYNAGEGRVRQWLSSPIYSEDGQNLSAIPYPETKNYVERVQ
NAYAMYNQLYREI

Enzyme Prediction     

No EC number prediction in MGYG000004160_00434.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	60	187	1.1e-31	0.7925925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16896	LT_Slt70-like	9.47e-76	40	183	1	144	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.77e-59	39	189	2	152	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd00254	LT-like	5.43e-43	60	184	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd16893	LT_MltC_MltE	3.38e-37	45	183	1	161	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
COG0741	MltE	5.83e-34	38	190	134	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QAT49510.1	4.92e-56	8	191	2	187
ACL76418.1	8.60e-51	3	190	5	191
QNK41497.1	4.21e-50	1	191	1	189
AEY66639.1	1.98e-49	3	190	5	191
QUH26942.1	4.97e-49	7	190	2	190

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FBT_A	6.01e-26	39	188	445	594	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]
5OHU_A	6.25e-26	39	188	474	623	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FCQ_A	1.53e-25	39	188	445	594	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCR_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCS_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa],6FCU_A Chain A, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FC4_A	1.53e-25	39	188	446	595	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
1QSA_A	4.11e-21	35	179	445	591	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	1.71e-21	44	183	61	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
P0AGC3	2.28e-20	35	179	472	618	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	2.28e-20	35	179	472	618	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
O64046	4.97e-20	38	184	1417	1542	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	4.97e-20	38	184	1417	1542	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999977	0.000025	0.000001	0.000000	0.000000	0.000004

TMHMM  Annotations     

start	end
12	34