CAZyme Information: MGYG000004157_00461

Basic Information

• Species: HGM11514 sp900757255
• Lineage: Bacteria; Firmicutes_A; Clostridia; HGM11514; HGM11514; HGM11514; HGM11514 sp900757255
• CAZyme ID: MGYG000004157_00461
• CAZy Family: GH63
• CAZyme Description: Periplasmic trehalase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
567	MGYG000004157_8|CGC1	65705.69	6.8806

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004157	2480742	MAG	United Kingdom	Europe

• Gene Location: Start: 5489; End: 7192 Strand: +

Full Sequence      

MDLPNIWGQGALFCFSGLDGECQYHQSFACTLLADHLGVRIHTPELIDLYISVNNIKDVH
YKIVASDIIIAELTTADNEKYNTSFVFYNQNTIIGLCRKNSLHLNPVDSSFTCKTSGNYK
VYSGTKSTVYLSETEAKEYTCFSVSTAKNNINIPKAVDETIETKLQFYKNLPELRIKDPK
ISRTFYKCISVMKSQVYSAEGQFKHFWTTPDKLPHKNLWLWDSVFHSLGNRFIDKNLARD
SLLSVLDTQKPDGLIPHMSTPYYSSNITQPPVLAWGFWEYYKNTSDISILKKAYPKLESY
LKWNLKNRRCESGLFQWYINTEDKNCRCDESGMDNSPRFDHAVSMECIDFSCFMVTEAES
MAKICKSINEERCQYWERFAADLKNSINKYLWDETDAFYFDRITSDKTFQKTKSVASFLP
LFAGVCDETKAQKLVESLNNIKTFKDSFNIPSISKEDPTFGTDMWRGPVWINYNYFISCG
LKRYGYVKEADSIIQKTLTEIAKYYHYDGTVYEFYDSACQKSPSKLMRKGEVIEPYNIYT
RMQTIRDYGWTAALFVHMLLENPGLFE

Enzyme Prediction     

No EC number prediction in MGYG000004157_00461.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	178	558	9.7e-42	0.43333333333333335

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	2.46e-23	198	559	323	779	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	2.65e-21	220	516	94	469	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG1626	TreA	3.18e-16	295	559	295	549	Neutral trehalase [Carbohydrate transport and metabolism].
pfam01204	Trehalase	2.24e-15	207	516	108	474	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
COG3408	GDB1	1.83e-12	214	516	280	579	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTE69242.1	1.78e-155	1	567	1	553
AVM44395.1	2.23e-101	154	564	118	532
AHF91275.1	3.34e-87	158	562	189	594
QDU87506.1	1.39e-50	216	516	120	422
ADY59251.1	5.08e-46	218	516	94	395

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3W7S_A	9.31e-16	179	543	277	760	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	3.75e-15	179	543	277	760	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	4.96e-15	179	543	277	760	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
4WVA_A	1.67e-14	219	490	32	375	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
3D3I_A	8.03e-14	179	543	278	761	Crystalstructural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12],3D3I_B Crystal structural of Escherichia coli K12 YgjK, a glucosidase belonging to glycoside hydrolase family 63 [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D8T3S4	1.35e-17	207	515	86	461	Mannosylglycerate hydrolase MGH2 OS=Selaginella moellendorffii OX=88036 GN=SELMODRAFT_447962 PE=3 SV=1
D8QTR2	2.40e-17	207	515	86	461	Mannosylglycerate hydrolase MGH1 OS=Selaginella moellendorffii OX=88036 GN=MGH PE=1 SV=1
P42592	5.21e-15	179	543	300	783	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1
P49381	1.96e-10	330	526	477	689	Cytosolic neutral trehalase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=NTH1 PE=1 SV=1
P53008	5.14e-08	200	484	403	762	Mannosyl-oligosaccharide glucosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CWH41 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004157_00461.