CAZyme Information: MGYG000004153_00580

Basic Information

• Species: UBA7102 sp900760085
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; UBA1750; UBA7102; UBA7102 sp900760085
• CAZyme ID: MGYG000004153_00580
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	MGYG000004153_6|CGC1	69651.86	5.5424

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004153	2844425	MAG	United Kingdom	Europe

• Gene Location: Start: 17260; End: 19107 Strand: +

Full Sequence      

MMPKEYKDLCAAHVRGFQTWNTRSVLSHVDMETGYALNVCLKDGANGQYLKEALIGRFGE
QEEKVTPEAHAWDGGYTSVKVEFQGVRFRVESCRCEDAPLILLVTPLSRELRAPLLVLES
GFLWNRPGVLGREKNTLLAVAGKKRFVVYSTAPHNPQDANFPTQTPYLAADFDREIAFAV
NAPLEIAEVRRRMAAAREAYEESRARFAPCEDFYEALRLAMTWDTTYDAKNERVLTPVSR
LWSIQHGGFVLFCWDNYFAGFLAALCDKFLAYSNLIAITSSRTAAGFVPNFANGTGLKSE
DRSQPPVGSAMLVEVYRLHGEKWIVEALYPALLQWNEWFAAHRMEDSGALCWGSDPVTPV
FGNRWEVDGVCDRFGAALESGLDNSPMYDDIPFDKETHRLKLADVGLTGLYILDTRSLLQ
LAKVLGREQDVPALEARLRRAQAGLETLWDEDFGFYCNRRTDTGAFSHRISPTNFYALFD
RSVPKARRERIAAHYWNPEEFYGEWMLPSIARNDPAFPEQDYWRGRVWAPLNFLVYLAFC
QHADLARERADLAEKSAALFLPEWQENRHIHENYNAVTGQGCDRPNSDKFYHWGALLGAL
VMAEKGLLSSLGADL

Enzyme Prediction     

No EC number prediction in MGYG000004153_00580.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	248	595	6e-25	0.3508771929824561

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03200	Glyco_hydro_63	3.92e-11	328	604	191	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
PRK10137	PRK10137	1.05e-06	285	528	390	712	alpha-glucosidase; Provisional
COG3408	GDB1	7.24e-06	371	601	383	604	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
PLN02567	PLN02567	4.69e-05	254	336	156	240	alpha,alpha-trehalase
COG1626	TreA	2.19e-04	209	492	126	442	Neutral trehalase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNK58860.1	4.13e-185	5	606	17	616
QTH44429.1	1.53e-179	3	606	14	615
QNI32096.1	1.71e-169	15	605	7	601
QTD47584.1	1.24e-153	15	615	39	635
ANH81205.1	1.60e-153	4	606	28	634

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WVA_A	1.43e-13	383	597	220	414	Crystalstructure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVA_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris [Thermus thermophilus HB8],4WVB_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVB_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with glucose [Thermus thermophilus HB8],4WVC_A Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8],4WVC_B Crystal structure of GH63 mannosylglycerate hydrolase from Thermus thermophilus HB8 in complex with Tris and D-glycerate [Thermus thermophilus HB8]
2Z07_A	4.47e-13	383	597	220	414	Crystalstructure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus],2Z07_B Crystal structure of uncharacterized conserved protein from Thermus thermophilus HB8 [Thermus thermophilus]
3W7S_A	7.11e-08	254	595	323	746	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.81e-07	254	595	323	746	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	3.70e-07	254	595	323	746	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P42592	3.94e-07	254	595	346	769	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004153_00580.