CAZyme Information: MGYG000004146_01858

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UMGS1397
• CAZyme ID: MGYG000004146_01858
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
651	MGYG000004146_69|CGC1	73789.73	7.4872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004146	2399745	MAG	United Kingdom	Europe

• Gene Location: Start: 877; End: 2832 Strand: +

Full Sequence      

MKIVLVIDQFDSGNNGTTVTARRFAEQLCLRGHSVTVLACGESSASVGEVGINKVGVPEF
RLPVFDGLIKSQGMQFARPVDEAYYQAFHGADIIHFYLPFRFCRRGEEIARQMHIPTVAA
FHMQPENVTFSIGMGNWTFLNDRLYSWCYREFYNRFTHIHCPSRFIADQLEKHGYDAKLC
VISNGVDDAFVPRPDISRPPEFEGKFVVLMVGRLSGEKRQDLIIEAAKRSKYREKIQLIF
AGKGPKEQEYRRLSEGLPNPPVFGFYSQEELVALMNGCDLYIHASDAEIEGISCMEALAC
GLVPVISDSERSATNQYALDERSLFKAGDAGSLAEKIDYWITNPEERERMGKEYAHVGDG
IRVSACVAQAEAMYRDAIQEYHDHGYKHPRQGPLKRRLHPNTEKIEAAEFEYCPSSPFQR
GRLAFLTNLFTPLLVMIDALVFGFSVEGRRYLEGLNGGITVMNHVHPMDCTMAKIATFPT
RTYFISLRRNLELPFTGWLVRLFGGVPIPEAPREMKQFQRQIEEAVLRGDFVHFYPEGQL
VRYHESLRAFHRGAFFTAVRTGRPVIPMVMTYRKPGPLLALFKRKPCLRLLICEPQFADP
SLTKAAAVKELMARTRRVMEERASGPSPDYRRQPAAALPDELVEAGEAIET

Enzyme Prediction     

No EC number prediction in MGYG000004146_01858.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	203	352	1.2e-25	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03817	GT4_UGDG-like	3.29e-72	2	353	1	351	UDP-Glc:1,2-diacylglycerol 3-a-glucosyltransferase and similar proteins. This family is most closely related to the GT1 family of glycosyltransferases. UDP-glucose-diacylglycerol glucosyltransferase (EC 2.4.1.337, UGDG; also known as 1,2-diacylglycerol 3-glucosyltransferase) catalyzes the transfer of glucose from UDP-glucose to 1,2-diacylglycerol forming 3-D-glucosyl-1,2-diacylglycerol.
cd03801	GT4_PimA-like	4.22e-46	2	375	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	1.33e-42	1	380	1	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03814	GT4-like	1.35e-33	2	355	1	345	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases and includes a sequence annotated as alpha-D-mannose-alpha(1-6)phosphatidyl myo-inositol monomannoside transferase from Bacillus halodurans. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in bacteria and eukaryotes.
pfam00534	Glycos_transf_1	7.96e-32	204	352	1	153	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANW99047.1	3.28e-232	1	626	3	616
ANX01575.1	3.28e-232	1	626	3	616
AGC68714.1	3.28e-232	1	626	3	616
AGI39723.1	3.28e-232	1	626	3	616
ABN52751.1	1.15e-157	1	595	30	597

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QHP_A	4.55e-41	206	355	3	152	Crystalstructure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695],3QHP_B Crystal structure of the catalytic domain of cholesterol-alpha-glucosyltransferase from Helicobacter pylori [Helicobacter pylori 26695]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004146_01858.